KEGG   Enhydra lutris kenyoni (northern sea otter): 111146783
Entry
111146783         CDS       T05871                                 

Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04110  Cell cycle
elk04151  PI3K-Akt signaling pathway
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04350  TGF-beta signaling pathway
elk04390  Hippo signaling pathway
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04630  JAK-STAT signaling pathway
elk04919  Thyroid hormone signaling pathway
elk05132  Salmonella infection
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05216  Thyroid cancer
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111146783
   04012 ErbB signaling pathway
    111146783
   04310 Wnt signaling pathway
    111146783
   04350 TGF-beta signaling pathway
    111146783
   04390 Hippo signaling pathway
    111146783
   04630 JAK-STAT signaling pathway
    111146783
   04151 PI3K-Akt signaling pathway
    111146783
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111146783
   04218 Cellular senescence
    111146783
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111146783
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111146783
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111146783
   05202 Transcriptional misregulation in cancer
    111146783
   05206 MicroRNAs in cancer
    111146783
   05205 Proteoglycans in cancer
    111146783
   05230 Central carbon metabolism in cancer
    111146783
  09162 Cancer: specific types
   05210 Colorectal cancer
    111146783
   05225 Hepatocellular carcinoma
    111146783
   05226 Gastric cancer
    111146783
   05216 Thyroid cancer
    111146783
   05221 Acute myeloid leukemia
    111146783
   05220 Chronic myeloid leukemia
    111146783
   05219 Bladder cancer
    111146783
   05213 Endometrial cancer
    111146783
   05224 Breast cancer
    111146783
   05222 Small cell lung cancer
    111146783
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111146783
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111146783
   05161 Hepatitis B
    111146783
   05160 Hepatitis C
    111146783
   05163 Human cytomegalovirus infection
    111146783
   05167 Kaposi sarcoma-associated herpesvirus infection
    111146783
   05169 Epstein-Barr virus infection
    111146783
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111146783
   03019 Messenger RNA biogenesis [BR:elk03019]
    111146783
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    111146783
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     111146783
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 111146783
NCBI-ProteinID: XP_022358172
UniProt: A0A2Y9JAX5
LinkDB
Position
Unknown
AA seq 439 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSSSPSPARGPGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSAAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPHAKRSESGSPSAGSHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQTEEQKLISEKDLL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaactatgacctcgactacgattcggtacag
ccttatttctactgcgacgaagaggagaacttctaccagcagcagcagcagagcgagctg
cagccgccggcccccagcgaggatatctggaagaaattcgagctgctgcccaccccgccg
ctgtccccgagccgccgctcagggctctgctcgccctcctacgttgcagtcgcgtccttc
tcccccaggggggacgacgacggcggcggcggcagcttttccaccgctgaccagttggag
atggtgaccgagctgctgggaggggacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgcatgtggagcggcttctcggcc
gcggccaagctggtctctgagaagctagcctcctaccaggctgcgcgcaaggacagcagc
agcccgagccccgcccgcgggcctggaggctgctccacctccagcctgtacctgcaggac
ctgagcgccgccgcctccgagtgcatcgacccctccgtggtcttcccctacccgctcaac
gacagcagctcgcccaagccctgcgcctccccggactccgccgccttctctccgtcctcg
gactctctgctctcctcggccgagtcgtccccgcgggccagtcccgagcccctggcgctc
catgaggaaacaccacccaccacaagcagcgactctgaggaagaacaagaggatgaagaa
gaaattgatgtcgtttctgtggaaaaaaggcagccccatgccaaaaggtcagaatcgggg
tcaccctcggcaggaagccacagcaaaccccctcacagcccgctggttcttaagagatgc
catgtgtccacccatcagcacaattatgcagcgcccccctccaccaggaaggactatcca
gctgccaagagggctaagttggacagtggcagagtcctgaaacagatcagcaacaaccgc
aaatgtgccagccccaggtcttcagacacagaggagaatgacaagaggcggacacacaac
gtcttagaacgccagaggagaaacgagctgaaacggagcttctttgccctgcgtgaccag
atcccagagttggaaaacaatgaaaaggcccccaaggtagtcatccttaaaaaagccacc
gcatatatcctgtctgtccagacagaagagcagaagctcatttcagaaaaggacttgttg
cggaagcggcgagaacagttaaaacacaaacttgaacagctaaggaactctggtgcctaa

DBGET integrated database retrieval system