KEGG   Enhydra lutris kenyoni (northern sea otter): 111146791
Entry
111146791         CDS       T05871                                 

Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04110  Cell cycle
elk04114  Oocyte meiosis
elk04115  p53 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04218  Cellular senescence
elk04934  Cushing syndrome
elk05161  Hepatitis B
elk05162  Measles
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05206  MicroRNAs in cancer
elk05215  Prostate cancer
elk05222  Small cell lung cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111146791
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111146791
   04114 Oocyte meiosis
    111146791
   04115 p53 signaling pathway
    111146791
   04218 Cellular senescence
    111146791
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111146791
   05206 MicroRNAs in cancer
    111146791
   05203 Viral carcinogenesis
    111146791
  09162 Cancer: specific types
   05226 Gastric cancer
    111146791
   05215 Prostate cancer
    111146791
   05222 Small cell lung cancer
    111146791
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111146791
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111146791
   05161 Hepatitis B
    111146791
   05162 Measles
    111146791
   05169 Epstein-Barr virus infection
    111146791
   05165 Human papillomavirus infection
    111146791
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:elk03032]
    111146791
   03036 Chromosome and associated proteins [BR:elk03036]
    111146791
DNA replication proteins [BR:elk03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    111146791
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    111146791
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111146791
NCBI-ProteinID: XP_022358181
UniProt: A0A2Y9JC66
LinkDB
Position
Unknown
AA seq 404 aa
MSRRSSRLQAKQQPQPSQTDSPQEAQIVQAKRRKTAQDVKKRKEEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKDVWLNMLKK
ETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILTIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDNISECVDWMVPFVSVVKSTSPVKLKIFKKISMEDRHNIQTH
TNYLAMLDEVNYVNTFRKGGQLSPVCSGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcaacagccccagcccagccagacggac
tccccccaggaagcccagatagtccaggccaagaggagaaaaacagctcaggatgtcaaa
aaaagaaaagaggaggtcaccaagaaacaccagtatgagattaggaactgttggccacct
gtattatctggggggatcagtccttgtattatcattgaaacaccccacaaagaaatagga
acaagtgacttctcccgatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagttggggatgttcaaaggatgtttggctaaacatgctaaaaaag
gagaccaggtatgttcatgacaaacattttgaagttctgcattctgacttggaaccacag
atgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcataga
gaaacattttaccttgcgcaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaacttgag
gaaatatatgctcctaaactacaagagtttgcttatgttactgatggtgcctgcagtgaa
gaggatatcttaagaatggaacttattatattaaaggctttaaaatgggaactctgtcct
gtaacagtcatctcctggctaaatctcttcctccaagttgatgctcttaaggatgctcct
aaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagcttttagat
ctgtgtattcttaccatcgattcattagagttccagtacagaatattggctgccgctgcc
ttatgccactttacctctattgaagtggtgaagaaagcctcaggtttggaatgggacaac
atatctgaatgtgtagactggatggtgccttttgtcagtgtagtaaaaagtactagtccc
gtgaagctgaagattttcaagaagatttctatggaagatagacacaatatccagacacat
acaaattatctggctatgctggatgaagtaaattacgtaaacaccttcagaaagggtgga
cagttgtcaccagtgtgcagtggaggcattatgacaccaccgaagagcactgaaaaacca
ccaggaaaacactaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161443
Entry
111161443         CDS       T05871                                 

Definition
(RefSeq) G1/S-specific cyclin-E1 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04110  Cell cycle
elk04114  Oocyte meiosis
elk04115  p53 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04218  Cellular senescence
elk04934  Cushing syndrome
elk05161  Hepatitis B
elk05162  Measles
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05206  MicroRNAs in cancer
elk05215  Prostate cancer
elk05222  Small cell lung cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111161443
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111161443
   04114 Oocyte meiosis
    111161443
   04115 p53 signaling pathway
    111161443
   04218 Cellular senescence
    111161443
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161443
   05206 MicroRNAs in cancer
    111161443
   05203 Viral carcinogenesis
    111161443
  09162 Cancer: specific types
   05226 Gastric cancer
    111161443
   05215 Prostate cancer
    111161443
   05222 Small cell lung cancer
    111161443
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111161443
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111161443
   05161 Hepatitis B
    111161443
   05162 Measles
    111161443
   05169 Epstein-Barr virus infection
    111161443
   05165 Human papillomavirus infection
    111161443
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:elk03032]
    111161443
   03036 Chromosome and associated proteins [BR:elk03036]
    111161443
DNA replication proteins [BR:elk03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    111161443
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    111161443
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Connexin50
Other DBs
NCBI-GeneID: 111161443
NCBI-ProteinID: XP_022380801
UniProt: A0A2Y9L4H7
LinkDB
Position
Unknown
AA seq 410 aa
MPREKRERDAKERDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIAKMDRTVRSQCGIQ
PWDNNSVCENPCSFIPTPDKEEGEPASPSSACGPQSFMPSRASPLPILNWANRDEVWKIM
LNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGEEILSMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQHIFIQIAELLDLCVLDVGCLEFPYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQAKKAILSEQNRISPLPTGVLTPPQSSKKQSNEQGTA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagaagagggagagggatgcaaaggaacgggacaccatgaaggaggaaagt
ggcactgatgtctctgttcgttccaggaaaaggaaggcaaatgtggctgtttttttgcag
gatccagatgaagaaattgcaaaaatggacaggactgtgagaagtcagtgcggcattcag
ccttgggacaataattctgtgtgtgaaaacccctgctccttcattcccacacctgacaag
gaagagggtgagccagcatccccaagttccgcgtgtggaccgcagagtttcatgccctcc
agagcctcaccactgcctatactgaactgggcaaatagagatgaggtgtggaaaattatg
ctaaacaaggagaagacatacttaagggataagcactttatgcagcggcaccctcttttg
cagcctaagatgcgagcaattcttctggattggttaatggaggtgtgcgaagtctataaa
cttcacagagagacattttacttggcccaggatttctttgatcggtatatggcaacacaa
caaaatattgtaaaaacacttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctatcctccaaagctgcaccagtttgcttacgttacagatggggct
tgttcaggagaggaaattcttagcatggaattaatcattatgaaggcccttaagtggcac
ttaagtcccctgaccattgtgtcctggctgaatgtgtatatgcaggttgcgtatctaaat
gacttatatgaagtgctcctgcctcagtatccccagcacatcttcatacagattgcagag
cttttagatctttgtgtcctggatgttggctgcttagaatttccctacggtgtacttgct
gcttctgccttgtatcatttctcctcatcggaattgatgcaaaaggtttcagggtatcag
tggtgtgatatagagaagtgtgtcaagtggatggttccatttgccatggttataagggag
acaggaagttccaaacttaagcacttcaggggagttcctgctgaagatgcgcacaacatc
cagacccatataaacagcttggatttgctggacaaagcccaagcaaagaaagccatattg
tctgaacaaaataggatttctcccctccccaccggggtcctcacccccccacagagcagt
aagaagcagagcaatgagcaggggaccgcgtga

DBGET integrated database retrieval system