KEGG   Enhydra lutris kenyoni (northern sea otter): 111146911
Entry
111146911         CDS       T05871                                 

Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04110  Cell cycle
elk04218  Cellular senescence
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05212  Pancreatic cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111146911
   04218 Cellular senescence
    111146911
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111146911
   05203 Viral carcinogenesis
    111146911
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111146911
   05225 Hepatocellular carcinoma
    111146911
   05226 Gastric cancer
    111146911
   05214 Glioma
    111146911
   05220 Chronic myeloid leukemia
    111146911
   05218 Melanoma
    111146911
   05219 Bladder cancer
    111146911
   05215 Prostate cancer
    111146911
   05224 Breast cancer
    111146911
   05222 Small cell lung cancer
    111146911
   05223 Non-small cell lung cancer
    111146911
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111146911
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111146911
   05161 Hepatitis B
    111146911
   05160 Hepatitis C
    111146911
   05163 Human cytomegalovirus infection
    111146911
   05167 Kaposi sarcoma-associated herpesvirus infection
    111146911
   05169 Epstein-Barr virus infection
    111146911
   05165 Human papillomavirus infection
    111146911
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111146911
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111146911
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111146911
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111146911
Transcription factors [BR:elk03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    111146911
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 FAM75 PsbQ TFIIB
Other DBs
NCBI-GeneID: 111146911
NCBI-ProteinID: XP_022358376
UniProt: A0A2Y9JCR0
LinkDB
Position
Unknown
AA seq 938 aa
MPPKTPRRAAAAAAAAAAAAAAAAAAAAEPPPPPPPPPPEEDPEQDSGPEDLPLPSLVLE
ETEEPDFTALCQKLKIPDHVKERAWLTWEKVSSVDGVLEGYVQRKKELWGICIFIAAVDL
DEMPFTFTELQKNIETSVCKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCE
LIYLTQPSTLISTEINSVLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLS
PPALLKEPYKTAVIPFNGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKN
VYFKNFIPFMNSLGIVASNGLPEVESLSKQYEEIYLKNKDLDARLFLDHDKTLQADPTDS
FEMQRTPRKSNSDEEVNVILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVN
PKESILKRVKDVGYIFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLKSEEERLSI
QNFSKLLNDNIFHMSLLACALEVVMATYSRNTSQNLDTGTDLSFPWILNILNLKAFDFYK
VIESFIKAEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPADHLEPAC
TLNLPLQSNHTAADMYLSPVRSPKKKGSTIRVNSTANTEGQATSAFQTQKPLKSTSLSLF
YKKVYRLAYLRLNTLCSRLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYG
ICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQ
YASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGVPTPTKMTPRSR
ILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKH
IPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNREEK
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagcagcagcagccgccgccgccgccgccgccgcc
gccgcagcagcagcagcggccgccgaacccccaccgccgccgccgccgcctcctcctgag
gaggaccccgagcaggacagtggccccgaggacctgcctctgcccagtctcgtgttggaa
gaaaccgaagaacctgattttaccgcattatgtcagaaattaaagataccagatcatgtc
aaagaaagagcttggttaacttgggagaaagtttcatctgtggatggagtattggaaggt
tatgttcaaaggaaaaaggagctatggggaatctgtatctttattgcagcagttgatcta
gatgagatgccattcacttttactgagctacagaaaaacatagaaaccagtgtctgcaaa
ttctttgatttactaaaagaaattgataccagtaccaaggttgataatgctatgtcgaga
ctgttgaagaagtataatgtattatgtgcgctctacagcaaattagaaaggacatgtgaa
cttatatatttgacacaacccagcactttgatatctactgaaataaactctgtgttggtg
ctaaaagtttcttggatcacatttttactagctaaaggggaagtgttacaaatggaggat
gatctcgtcatctcatttcagttaatgctctgtgtccttgactattttattaaactctca
cctcctgcattgcttaaagaaccgtataaaacagctgtaataccttttaatggttcacct
cgaacaccaaggcgaggtcagaacaggagtgcacggatagcaaaacaactagaaaatgat
acaagaattattgaagttctctgtaaagaacatgaatgtaatatagatgaggtgaaaaat
gtttatttcaaaaatttcataccttttatgaattctcttggaattgtagcttctaatgga
cttccagaggtggaaagtctctctaaacaatatgaagagatttaccttaaaaacaaagat
cttgatgcaagattatttctggatcatgataaaacccttcaggctgatcctacggacagt
tttgaaatgcagagaacgccacgaaaaagtaactctgatgaagaagtgaatgtaattctt
ccacaaactccagttaggactgttatgaatactatccaacaattaatgatgatcttaaat
tcagcaagtgatcaaccatcagaaaatctgatttcctattttaataactgcacagtgaat
ccaaaagaaagtatcttgaaaagagtgaaggatgttggatacatctttaaagagaaattt
gctaaagctgtgggacagggatgtatggaaattggatcacagcgatacaaacttggagtc
cgattgtattaccgagtaatggaatccatgcttaaatcagaagaagaacgattatccatt
caaaattttagcaaactcctgaatgacaacatctttcatatgtctttgttggcatgcgct
cttgaagtcgtaatggctacgtatagcagaaatacatctcagaatcttgatactggaaca
gatttgtccttcccatggattctgaatatacttaatttaaaagcctttgatttttacaaa
gtgattgaaagttttatcaaagcagaagccaacttgaccagagaaatgataaaacattta
gaacgatgtgaacatcgaatcatggaatcgcttgcatggctctctgattcacctttattt
gatttgattaaacaagcaaaagaccgagaaggaccagctgatcaccttgaacctgcttgt
actctcaaccttccactccagagtaatcacactgctgctgatatgtatctttctcctgta
agatccccaaagaaaaaaggatcaactatacgtgtaaattctactgcaaacacagaggga
caagcaacctcagccttccagactcagaagccattgaaatctacctccctttcacttttt
tacaaaaaagtgtaccgactagcatatcttcgactaaataccctgtgctcacgccttctg
tctgaccacccagaactagaacacatcatctggaccctttttcagcatacgttgcaaaat
gagtatgaactcatgagagacaggcatttggatcagattatgatgtgttccatgtatggc
atatgcaaagtgaagaatatagaccttaaattcaaaatcattgtaacagcatacaaagat
cttcctcatgctgttcaggagacattcaaacgtgttttgatcagagaagaggagtatgat
tccattatagtattctataactcggtcttcatgcagagactgaaaacaaatattttgcag
tatgcttctaccaggccccctaccttgtcaccaatacctcacattcctcgaagcccttac
aagttttctagttcacctttacggattcctgggggaaacatctatatatcacccctgaag
aatccatataaaatttcagaaggtgtgccaacgccaacaaaaatgactccaagatcaaga
atcttagtatcaattggtgaatcatttgggacttctgagaagttccagaaaataaatcag
atggtgtgtaacagcgatcgtgtgctcaaaagaagtgctgaaggcagcaaccctcctaaa
ccattgaaaaaactacgctttgatattgaaggatcagacgaagcagatggaagtaaacac
atcccaggggagtccaaatttcaacagaaactggcagaaatgacatctacccgaacacga
atgcagaagcaaaaaatgaacgatagcatggatacctcaaacagggaagaaaaatga

DBGET integrated database retrieval system