KEGG   Enhydra lutris kenyoni (northern sea otter): 111147246
Entry
111147246         CDS       T05871                                 

Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04218  Cellular senescence
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05206  MicroRNAs in cancer
elk05212  Pancreatic cancer
elk05214  Glioma
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111147246
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111147246
   04115 p53 signaling pathway
    111147246
   04218 Cellular senescence
    111147246
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111147246
   05206 MicroRNAs in cancer
    111147246
   05203 Viral carcinogenesis
    111147246
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111147246
   05225 Hepatocellular carcinoma
    111147246
   05214 Glioma
    111147246
   05220 Chronic myeloid leukemia
    111147246
   05218 Melanoma
    111147246
   05224 Breast cancer
    111147246
   05222 Small cell lung cancer
    111147246
   05223 Non-small cell lung cancer
    111147246
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111147246
  09172 Infectious disease: viral
   05160 Hepatitis C
    111147246
   05164 Influenza A
    111147246
   05162 Measles
    111147246
   05163 Human cytomegalovirus infection
    111147246
   05167 Kaposi sarcoma-associated herpesvirus infection
    111147246
   05169 Epstein-Barr virus infection
    111147246
   05165 Human papillomavirus infection
    111147246
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111147246
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111147246
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111147246
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 111147246
NCBI-ProteinID: XP_022358877
UniProt: A0A2Y9JCY8
LinkDB
Position
Unknown
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHAKAPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERRKENLDARLPPNQNSSDMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgcgcggaccagcagtacgagtgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgggtgcagacgggcgaggagggcatgccgctctctaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtatgcacagtgtcacgaacagacagagaaaccaaactgacattagtgtttgaacat
gtcgatcaagacttgaccacttacttggataaagtcccggagcctggcgtgcccactgaa
accataaaggacatgatgtttcagcttctccgaggtctagattttcttcattctcaccga
gtagtgcatcgtgacctaaaaccgcagaacattctggtgaccagcagtggacaaataaag
ctggctgacttcggccttgcccgcatctacagtttccagatggctcttacctcagtggtc
gtcacgctgtggtacagagctccagaagtcctgcttcagtccagctacgccacccccgtg
gacctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgg
ggaagttcagatgtcgatcagcttggaaaaatcttggacgtaattggactcccaggagaa
gaagactggcctagagatgttgcccttcccaggcaggcatttcacgcaaaagctcctcag
ccgattgagaagtttgtaacagatattgatgaacaaggcaaagacctacttctgaagtgc
ttaacattcaatccagccaaaagaatatcagcctacagtgccctgtctcacccatacttc
catgacctggagaggcgcaaggagaacctggacgcccgtctgccgcccaaccagaacagc
tcagacatgaacacagcctaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111160230
Entry
111160230         CDS       T05871                                 

Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04218  Cellular senescence
elk04530  Tight junction
elk04660  T cell receptor signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05212  Pancreatic cancer
elk05214  Glioma
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111160230
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111160230
   04115 p53 signaling pathway
    111160230
   04218 Cellular senescence
    111160230
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111160230
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111160230
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111160230
   05203 Viral carcinogenesis
    111160230
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111160230
   05225 Hepatocellular carcinoma
    111160230
   05214 Glioma
    111160230
   05220 Chronic myeloid leukemia
    111160230
   05218 Melanoma
    111160230
   05219 Bladder cancer
    111160230
   05224 Breast cancer
    111160230
   05222 Small cell lung cancer
    111160230
   05223 Non-small cell lung cancer
    111160230
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111160230
   04934 Cushing syndrome
    111160230
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111160230
   05160 Hepatitis C
    111160230
   05164 Influenza A
    111160230
   05162 Measles
    111160230
   05163 Human cytomegalovirus infection
    111160230
   05167 Kaposi sarcoma-associated herpesvirus infection
    111160230
   05169 Epstein-Barr virus infection
    111160230
   05165 Human papillomavirus infection
    111160230
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111160230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111160230
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111160230
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111160230
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 111160230
NCBI-ProteinID: XP_022378848
UniProt: A0A2Y9L0I5
LinkDB
Position
Unknown
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVDTIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKPEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctactcctcgatatgagccagtggctgagattggtgttggtgcctatggaacggta
tacaaggcccgtgatccccacagtggccacttcgtggccctcaagagcgtgagagtccct
aatggaggaggtgctggagggggccttcccatcagcacagttcgtgaggtggccttactg
aggcggctggaggcttttgagcatcccaacgttgtccggctgatggatgtctgtgccacc
gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcacgtggaccaagacctg
aggacgtatctggataaggcaccccccccaggcttgccagtggacaccatcaaggatctc
atgcgccagtttctaagaggcctagatttccttcatgccaactgcattgttcaccgagac
ctgaagccagagaacattctggtgaccagtggtgggacagtgaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgccccagaagttcttctgcagtctacatatgcaacacccgtggacatgtggagcgtt
ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagcc
gaccagttaggcaaaatctttgacctgatcgggctgcctccagaggacgactggccccga
gatgtgtctctaccccgaggagccttttcccccagagggccccgtccggtgcagtccgtg
gtacctgagttggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttacctacaaaagccagaaggt
aacccagagtga

DBGET integrated database retrieval system