KEGG   Enhydra lutris kenyoni (northern sea otter): 111147364
Entry
111147364         CDS       T05871                                 

Definition
(RefSeq) serine/threonine-protein kinase ATR isoform X1
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03460  Fanconi anemia pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04218  Cellular senescence
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    111147364
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111147364
   04115 p53 signaling pathway
    111147364
   04218 Cellular senescence
    111147364
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111147364
   05170 Human immunodeficiency virus 1 infection
    111147364
   05165 Human papillomavirus infection
    111147364
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111147364
Protein kinases [BR:elk01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   111147364
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111147364
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I
Other DBs
NCBI-GeneID: 111147364
NCBI-ProteinID: XP_022359076
UniProt: A0A2Y9JEQ8
LinkDB
Position
Unknown
AA seq 2644 aa
MGDHGLELASMIPALRELGSASPEEYNTVVQKPRQILCQFIDRILTDVNVVALELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVNGSQGQNEAKGSCIEFSNWIITRLLRIAATPSCH
MLHKKICEVICSLLFLFKSKNPVIFGVLTKELLHLFEDVIYLHRKNAVGHVVEWPVVVSQ
FLSQLDEHVGYLQPAPLQFMNMENLEFIEVTLLTVLIRIVAVVFFRRQELFLWQIGCVLL
EYGSPKIKSLAITLLTELFELGGLPAQPASTFFSSFLGLLKHLVEMDADQLKLYEEPLSK
LIKILFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKYV
PAGYESALEVRKVYVRNICRVLVDVLGFQVDAEYLLGPLYAALKMESMEIIEEVQSQIQQ
ENLSSNSDGISAKRRRLSSSLNSSKRPPKQTEEIKHVDMNKKSILWSALKQKAESLQIFL
ECGELKNPVIATLEGITVVLQLTALCTVHCSHQNMDCHDFKDCQQKCQKKPSVEITWMSL
DFYTTLLKSCRSLLESVQKPDLEAVIDKVVKIYDALIYIHMKTSFEDHILEDLCGMLSLP
WIHPHSDDGSLKLTTFATNLLALSRRISDSYSPQAQSRCVFLLTLFPRRVFLEWRTAVYT
WALQSSYEVIRASCVNGFFILLQQQNSCNRVPKILIDKVKDDSDIVQKEFASILGQLVCT
LHGMYYLTSSLAEPFSERGHTDLFCKSLKVTSQHECSSSQLKASICKPFLFLLKKKTPSP
VKLAFIDNLYHLCKHLDFREDEADVKTVLGALLNLMEDPDKDVRVAFSGNIKHILESLDS
EDGFIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLL
SKSASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPSTPCQNA
EMRKQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTL
GKQLNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHN
ELLLRIGEHYQQVFNGLSILASFASSDDPYQGPREITSPELMADYLQPKLLGILAFFNMQ
LLSSSIGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWD
CFVRCLDHAYLGSLLSHVIVALLPLIHIQPEETAAIFHYLIIENRDAVQDFLHEIYFLPD
HPELKKIKAVLQEYRKETSESTDLQTTLHLSMRAIQHENVDVRIHALTSLKETLYKNQEK
LIKYATDSETVEPVISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTESQ
GKDFTFVTGVEDSSFAFGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMQTDG
PGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGNNFAEWSASWAGY
LITKVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDRQEVYAEIMAVLK
HDDQHTISTQDSASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKFPQSKSNRDKLDSV
VSTADYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQ
KLYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYH
GVVKSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADAKS
TTWSVRLGQLLLSAKKRDITAFYDTLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHML
CELEHSIKPLFHQLPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYN
EMVGECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQ
KGVELCFPENKTPTESKNMLIHGRAMLLVGRFMEETANFESNAVMKKYKDVTLFLPEWED
GHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDF
GAKAYEWEKAGRSDRVQMRNDLAKINKVITEHTNHLAPYQFLTAFSQLISRICHSHDEVF
VVLMEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFIGDATR
LTDKLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEPTFSEILIPLQSVMIPTLPSIPGAH
ANHEPFPGHWAYIASFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME
FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY
MTGKELRQCMLPKAAALSEKLKVFREFLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRS
TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV
NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNET
GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGW
TPYM
NT seq 7935 nt   +upstreamnt  +downstreamnt
atgggcgaccacggcttggagctggcgtctatgatccccgctctgagggagttgggcagt
gccagtccagaggaatataatacagttgtacagaagccgagacaaattttatgtcagttc
attgaccgaatacttacagatgtaaatgttgttgctctagaacttgtaaagaaaactgac
tctcagccaacctctgtgatgttgcttgatttcatccagcatataatgaagtcttcccca
cttatgtttgtaaacgtgaatggaagccaaggccaaaatgaggccaaaggcagttgtatt
gaattcagtaattggatcataacaagacttctgaggattgcagcaactccatcctgtcat
atgttacacaagaaaatctgtgaagttatctgctcattattatttctttttaaaagcaag
aaccctgtaatttttggagttctgacaaaggaattactacatctttttgaagatgtcatt
tacctccatagaaaaaatgcagtgggacatgttgtggaatggccagtggtagttagccaa
tttttaagtcaattagatgaacatgtgggatatttacaaccagctcctttgcagttcatg
aacatggaaaatttagaatttattgaagtcaccttattaacagttcttattcgtattgtt
gcagttgtgttttttagaaggcaagaactctttctttggcagataggttgtgttctgcta
gagtatggtagtccaaagattaaatccttagcaattacccttttaactgaactcttcgag
cttggaggattaccagcacaaccagccagcactttcttcagctcttttttgggattatta
aaacatcttgtagaaatggatgctgaccagttgaaactctatgaagaaccattatcaaag
ctgataaaaatactgttcccctttgaagcagaagcttatagaaatattgaacctgtctat
ttaaatatgctactggaaaaactctgtgtcatgtttgaagatggtgtgcttatgcggctt
aagtctgatttgctaaaagcagctttgtgccacttactgcagtattttcttaaatatgtg
ccagctgggtatgaatctgctttagaagtcaggaaggtttatgtgagaaacatttgtaga
gttcttgtggatgtgcttggatttcaggtagatgcagagtatttgttgggcccactttat
gcagccttaaaaatggaaagtatggaaatcattgaggaggttcaaagccaaattcaacag
gaaaacctcagcagtaatagtgatggaatatcagccaaaaggcgtcgactcagctcatct
ctcaactcttccaaaagaccaccaaaacagactgaagaaattaaacacgtggatatgaac
aaaaagagcatactgtggagtgccctgaaacagaaagcagagtcccttcagattttcctt
gaatgtggtgaactaaagaatcctgttattgcaactttagaaggaatcactgttgtccta
cagctgactgctctgtgtacagttcattgttctcatcaaaacatggactgccatgatttc
aaggactgtcaacagaaatgtcagaagaaaccttcagtagagataacttggatgtctttg
gatttttacacaacactgcttaagagctgtaggagtttgttagaatctgttcagaagcct
gacctggaggcagttattgataaagtggtgaaaatatatgatgctctgatttatattcac
atgaaaacttcttttgaagatcatattctggaagatttatgtggaatgctctcacttcca
tggattcatcctcattctgatgatggctctttaaagttgaccacttttgccactaatctt
ttagcattaagccggaggatttcagatagctactcaccacaggcacaatcacggtgtgtg
tttcttctaactttatttccgagaagagtgttccttgaatggagaacagcagtttatacc
tgggccttacagagctcctatgaagtaatccgggctagttgtgttaatggattttttatc
ttactgcagcagcagaattcatgtaacagagttcccaagattcttatagataaagtcaaa
gatgattctgacattgtccagaaagaatttgcctctattcttggtcaacttgtctgtacg
cttcatggcatgtattatttgacaagttctttagcagaacctttctctgaacgtggacat
actgaccttttctgtaaaagcctaaaagttacttctcaacacgaatgttcatcttctcaa
ctaaaagcttctatttgcaagcctttccttttcctactaaaaaaaaaaacacctagtcca
gtgaaacttgctttcatagataatctatatcatctttgtaagcaccttgattttagagaa
gatgaagcagatgtgaaaacagttcttggagctttattaaatttaatggaagatccagac
aaggatgttagagtggcttttagtggaaatatcaagcatatattggaatccttggactct
gaagatggatttataaaagagctttttgtcttaagaatgaaggaagcatatacacatgct
caaatctcaagaaataatgagttgaaggataccttgattcttacaacaggggatattgga
agggcagcaaaaggagatttggtaccttttgcacttttgcatttattgcattgtttatta
tcgaagtcagcgtctgtctctggagcagcatatacagaaatcagagctctggttgcagct
aagagtgttaaactccaaaactttttcagccagtataagaaacccatctgtcagttttta
gtagaatcccttcattccagtcagatgacagcacttcctagtactccatgccagaatgct
gagatgcgaaaacaagatgtggctcaccagagagaaatggctttaaataccttgtctgaa
attgccaatgtttttgactttcctgatcttaatcgtttcctcactaggacattacaagtt
ctgctacctgaccttgccgccaaagcaagccctgcagcttctgctctcattcgaacttta
ggaaaacaattaaatgtcaatcgtagagagattttaataaataacttcaaatatattttt
tctcatttggtctgttcctgttccaaggatgaattagaacgtgcccttcattacctgaag
aatgaaacagaaattgaactgggcagtctattgagacaagatttccaaggattgcataat
gaattattgctacgtattggagaacactatcagcaggttttcaatggtttgtcaatactt
gcctcatttgcatctagtgatgatccatatcagggccccagagagatcacatcacctgaa
ttaatggctgattatttgcaacctaagttgttgggcattttggccttttttaacatgcag
ttactgagctccagtattggcattgaagataagaaaatggctttgaacagtttgatgtct
ttgatgaagttgatgggaccaaaacatgtcagttctgtgagggtgaagatgatgaccacg
ctaagaactggcctgagattcaaggatgattttcctgaattgtgttgcagagcttgggat
tgctttgttcgttgcttggatcatgcttatcttggttcccttctcagtcacgtgatagta
gctttgttacctctcatacacatccagcctgaagaaactgcagctatatttcactacctc
ataattgaaaacagggatgctgtacaagattttcttcatgaaatatactttttacctgat
catccagaattaaaaaagataaaagcagttctacaggaatacagaaaggagacctcagag
agtacagatcttcagacaactcttcatctatccatgagagcaattcagcatgaaaacgta
gatgttcgtattcatgctcttacaagtctgaaggaaactttgtataaaaatcaggaaaaa
ctgataaaatatgcaacagatagtgaaacagtggaacctgttatctcacagttggtgaca
gtgcttttgaaaggttgccaagatgcaaactctcaagctcggttgctctgtggagaatgt
ttaggggaattgggggcgatagatccaggtcgactagatttctcaacaactgaaagccaa
ggaaaagattttacatttgtgactggagtagaagattcaagcttcgcctttggattattg
atggaactaacaagagcttacctcgcatatgcagataatagccgggctcaagattcagct
gcttacgccattcaggagttactttctatttatgactgtagagagatgcagactgatggc
cccggtcaccagttgtggaggagatttcctgagcatgttcgggaaatcctggaacctcat
ctaaatactaggtataagagttctcagaagtcaacagattggtctggagtaaagaaacca
atttacttgagtaaattaggtaataactttgcagaatggtcagcatcttgggcaggttat
ctcataacaaaggttcggcatgatcttgccagtaaaatcttcacctgttgtagcattatg
atgaaacatgatttcaaggtgaccatctatcttcttccacatattctagtgtatgtcttg
ttgggttgtaatcaggaagatcggcaagaggtttatgcagaaattatggcagttctaaag
catgatgatcaacataccataagtacccaagacagtgcatctgatctgtgtcagctcagt
acacaaactgtgttctccatgcttgaccatctcacacagtgggcaaggcacaaatttcag
gcactgaaggcagagaaatttcctcaaagcaaatccaacagagataaattagactcagta
gtatctactgcggattatgaagactatcagagtgtaactcgttttctagacctcatacct
caggataccctggcagtagcttcctttcgctccaaagcatatacacgagctgtaatgcac
tttgaatcatttattacagaaaagaaacaaaatattcaagagcatcttggatttttacag
aaattgtacgctgctatgcatgaaccagatggagtagctggagtaagcgcaattcgaaag
gcagaaccatctctgaaagaacagatccttgaacatgaaagcattggcttactgagggat
gctactgcttgttatgatagggctattcagctagaaccagaccagatcattcattatcat
ggggtagtgaagtccatgttaggtcttggtcagctgtctactgtaatcactcaggtgaat
ggagtacatgctaacaggtctgaatggacagatgaattaaacacatacagagtggaagca
gcttggaaattgtcacagtgggatttggtggaaaactatttggcagcagatgcgaaatct
acaacatggagtgtcagactgggacagctattattatcagccaaaaaaagagatatcaca
gctttttatgacacactgaaactagtgagagcagaacaaattgtacctctttcagctgca
agctttgaaagaggctcttaccaacgaggatatgaatatattgtgaggttgcacatgttg
tgtgagttggagcatagcatcaaaccactttttcaccagttgccaggtgacagttctcaa
gaagattctctaaactgggtagctcgactagaaatgacccagaattcctacagagccaaa
gagcccatcctggctcttcggagagctttattaagtctcaacaaaagaccagattacaat
gaaatggttggagaatgctggctacagagtgccagagtagctagaaaagccggtcaccac
cagacagcctacaatgctctccttaatgctggagaatcacgacttgccgaactgtatgtg
gaaagggcaaagtggctatggtccaagggtgatgttcatcaggcactaattgttcttcag
aagggtgttgaattgtgttttcctgaaaataaaacaccaactgagagtaagaacatgtta
atccatggccgagctatgctactagtgggccgatttatggaagaaacagctaactttgaa
agcaatgcagttatgaaaaaatataaggatgtgaccttgtttctgccagagtgggaggat
gggcatttttaccttgccaagtactatgacaaattgatgcccatggtcacagacaacaaa
atggaaaagcagggtgatctcattcggtatatagttcttcattttggcagatctctccaa
tatggaaaccaattcatatatcagtcaatgccacgaatgttatcactatggcttgatttt
ggtgctaaagcatatgaatgggaaaaagctggccgttctgatcgtgtacaaatgagaaat
gatttagctaaaataaacaaggttatcacagagcacacaaatcacttagcaccgtatcag
tttttgactgctttttcacagttgatctcccgaatttgtcattctcatgatgaagttttt
gttgtcttgatggaaattatagctaaagtgtttctagcctatcctcagcaagcaatgtgg
atgatgacagctgtgtcaaagtcttcttatcccatgcgtgtgaacagatgcaaggaaatc
ctaaataaagctattcatatgaaaaaatccttagaaaaatttattggcgatgcaactcgc
ctaacagacaagcttctggaattgtgcaataaaccggtggatggaagtagttccacatta
agcatgagcactcattttaaaatgcttaaaaagctggtagaagaaccaacatttagtgaa
atcctcattcctttacagtcagtcatgatacctactcttccatcaattccgggtgcccat
gctaaccatgagccatttcctgggcactgggcctatatcgcaagctttgatgatatggtg
gaaattcttgcttctcttcagaaaccaaagaagatctctttgaaaggatcagatggaaag
ttctacatcatgatgtgtaagccaaaagatgacctgagaaaggattgtagactaatggaa
ttcaattccttgattaataagtgcttaagaaaagatgcagaatctcgtagaagagagctt
catattcgaacgtatgcagttattcccctgaatgatgaatgtgggattattgaatgggtt
aacaacactgctggcttgagacctattctgaccaaactatataaggaaaagggagtttat
atgacaggaaaagaacttcgccagtgtatgctaccaaaagctgcagctttgtctgaaaaa
ctcaaagtgttccgagaatttctcctacccaggcatcctccagtttttcatgagtggttt
ctgaggacattccctgatcctacatcatggtacagtagcagatcagcatactgccgttcc
actgcagttatgtcaatggttggttatatcctggggcttggagaccgtcatggtgaaaac
attctctttgattctctgactggtgaatgtgtacatgtagatttcaactgtctcttcaat
aagggagaaacctttgaggttccagaaattgttccatttcgactaactcataatatggtt
aatggaatgggtcctatgggaacagaaggtctttttcgaagggcttgtgaagttacaatg
aggctgatgcgagatcagagagagcctttaatgagtgtcttaaaaacttttctacatgat
cctcttgtggaatggagtaaaccagtgaaaggacattccaaagcaccactgaatgaaact
ggggaggttgtcaatgaaaaggccaagacccatgttcttgacatcgagcagcgactgcaa
ggtgtaatcaagacccgaaacagagtgacagggctgccattatctatcgaaggacatgtg
cattacctaatacaagaagctactgatgaaaacttactgtgccaaatgtaccttggttgg
accccatatatgtga

DBGET integrated database retrieval system