KEGG   Enhydra lutris kenyoni (northern sea otter): 111147365
Entry
111147365         CDS       T05871                                 

Definition
(RefSeq) interleukin-6 isoform X1
  KO
K05405  interleukin 6
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01523  Antifolate resistance
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04218  Cellular senescence
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04657  IL-17 signaling pathway
elk04659  Th17 cell differentiation
elk04668  TNF signaling pathway
elk04672  Intestinal immune network for IgA production
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05010  Alzheimer disease
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05134  Legionellosis
elk05135  Yersinia infection
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05144  Malaria
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05321  Inflammatory bowel disease
elk05323  Rheumatoid arthritis
elk05332  Graft-versus-host disease
elk05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111147365
   04668 TNF signaling pathway
    111147365
   04066 HIF-1 signaling pathway
    111147365
   04068 FoxO signaling pathway
    111147365
   04151 PI3K-Akt signaling pathway
    111147365
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111147365
   04061 Viral protein interaction with cytokine and cytokine receptor
    111147365
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111147365
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111147365
   04620 Toll-like receptor signaling pathway
    111147365
   04621 NOD-like receptor signaling pathway
    111147365
   04623 Cytosolic DNA-sensing pathway
    111147365
   04625 C-type lectin receptor signaling pathway
    111147365
   04659 Th17 cell differentiation
    111147365
   04657 IL-17 signaling pathway
    111147365
   04672 Intestinal immune network for IgA production
    111147365
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111147365
   05202 Transcriptional misregulation in cancer
    111147365
  09163 Immune disease
   05323 Rheumatoid arthritis
    111147365
   05321 Inflammatory bowel disease
    111147365
   05332 Graft-versus-host disease
    111147365
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111147365
   05020 Prion disease
    111147365
   05022 Pathways of neurodegeneration - multiple diseases
    111147365
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111147365
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111147365
   04931 Insulin resistance
    111147365
   04933 AGE-RAGE signaling pathway in diabetic complications
    111147365
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111147365
   05135 Yersinia infection
    111147365
   05133 Pertussis
    111147365
   05134 Legionellosis
    111147365
   05152 Tuberculosis
    111147365
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111147365
   05161 Hepatitis B
    111147365
   05171 Coronavirus disease - COVID-19
    111147365
   05164 Influenza A
    111147365
   05162 Measles
    111147365
   05168 Herpes simplex virus 1 infection
    111147365
   05163 Human cytomegalovirus infection
    111147365
   05167 Kaposi sarcoma-associated herpesvirus infection
    111147365
   05169 Epstein-Barr virus infection
    111147365
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111147365
   05144 Malaria
    111147365
   05142 Chagas disease
    111147365
   05143 African trypanosomiasis
    111147365
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111147365
   01523 Antifolate resistance
    111147365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111147365
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111147365
SSDB
Motif
Pfam: IL6 IL11 GCSF
Other DBs
NCBI-GeneID: 111147365
NCBI-ProteinID: XP_022359074
UniProt: A0A2Y9JMJ8
LinkDB
Position
Unknown
AA seq 210 aa
MNSLSTSAFSPVAFSLGLLLVMATAFPTPGPLGGDSKDDATSNRPPLTSADKMEDFIKFI
LGKISALRNEMCDKYNKCEDSKEVLAENNLNLPKLAEKDRCFQSRFNQETCLTRITTGLQ
EFQLHLKYLESNYEGNKDNAHSVYISTKHLLQTLRPMNQIEVTTPDPTTDASLQALFKSQ
DKWLKHTTIHLILRRLEDFLQFSLRAIRIM
NT seq 633 nt   +upstreamnt  +downstreamnt
atgaactccctctccacaagcgccttcagtccagtggccttctctctgggactgctcctg
gtgatggctactgctttccctaccccgggacccctgggaggagattccaaagatgatgcc
acctcaaacagaccaccactcacctctgcagacaaaatggaagacttcattaagttcatc
cttggcaaaatctctgcactgagaaatgagatgtgtgacaagtataacaagtgtgaagac
agcaaggaggtgctggcagagaacaacctaaatcttccaaaactggccgaaaaggacaga
tgcttccagtctcgattcaatcaggagacctgtctgacaagaatcactaccggtcttcag
gagtttcagttacacctgaaatacctagagtccaactatgagggtaataaggacaatgcc
cactctgtgtacatcagcaccaaacacctgctccagacgctgaggcccatgaatcagatt
gaagtgaccacccccgaccctaccacagatgccagcctgcaggctctcttcaagtcgcag
gacaagtggctgaaacacacaacaattcacctcatcctacggagacttgaggatttcctg
cagttcagcctgagggccattcggatcatgtag

DBGET integrated database retrieval system