KEGG   Enhydra lutris kenyoni (northern sea otter): 111147726
Entry
111147726         CDS       T05871                                 

Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04066  HIF-1 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04370  VEGF signaling pathway
elk04510  Focal adhesion
elk04926  Relaxin signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05219  Bladder cancer
elk05323  Rheumatoid arthritis
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111147726
   04014 Ras signaling pathway
    111147726
   04015 Rap1 signaling pathway
    111147726
   04370 VEGF signaling pathway
    111147726
   04066 HIF-1 signaling pathway
    111147726
   04020 Calcium signaling pathway
    111147726
   04151 PI3K-Akt signaling pathway
    111147726
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111147726
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111147726
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111147726
   05206 MicroRNAs in cancer
    111147726
   05205 Proteoglycans in cancer
    111147726
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111147726
   05211 Renal cell carcinoma
    111147726
   05219 Bladder cancer
    111147726
  09163 Immune disease
   05323 Rheumatoid arthritis
    111147726
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111147726
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111147726
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111147726
   05167 Kaposi sarcoma-associated herpesvirus infection
    111147726
   05165 Human papillomavirus infection
    111147726
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111147726
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111147726
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111147726
Cytokines and growth factors [BR:elk04052]
 Growth factors
  Growth factors (RTK binding)
   111147726
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111147726
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 111147726
NCBI-ProteinID: XP_022359656
UniProt: A0A2Y9JGC6
LinkDB
Position
Unknown
AA seq 572 aa
MEPRERRGLGQPGCKEAAARGASGTGGSGAGSEGAAARRKNRRDHRPGVSALEFDIHFSR
VYPPLFFFSNFKIHILSRFNLFFASHSPLKSGRPFGEIAPLLPPITSDFGNLQREERGSK
SSRREVEEERERRGQRARAGEASNDRDRVKVSDLLLGVTARARREPSPSGSRIGPAALTD
RQTDTAPRPNSHLLPGGRPRVDAATSRGQEPEPAPGGGVEGVGARGVAVKLFVQLLGCSR
SGGAVVRAGAAEPSGTRRSASSGREEPQSEEGEEEEEEKEEERGPRWRLGARKPGSWTGE
AAVCADSAPAARAPQALARASASGGRGDRLGAEESGPPRSPSRRGSASRAGSGRASETMN
FLLSWVHWSLALLLYLHHAKWSQAAPMAEGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQ
EYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFL
QHSKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKPWSVPCGPCSERRKHLFVQDPQ
TCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggagcctagggagcgcagaggcttggggcagccgggctgcaaggaggccgcggcgcgg
ggggcgagtggaaccggcggcagcggcgctgggtcggaaggcgcagcggcgaggcggaag
aaccggcgggatcaccggccaggggtctccgcactggaatttgatattcatttttccagg
gtttaccctcctctttttttcttcagcaattttaaaatccacattctttcccgttttaat
ttattttttgcttcccattccccgctaaaatcgggccgaccgtttggggagatcgctcct
ttacttcccccaatcacttcggattttggaaacctgcagagagaagaaagaggtagcaag
agctccagaagagaagtagaggaagagagagagagacggggtcagagagcgcgcgcgggc
gaagcgagcaacgacagggacagggtcaaagtgagtgacctgcttttgggggtgaccgcc
agagcgcggcgtgagccctccccctcgggatcccgcatcggaccagcagcgctgacggac
agacagacagacaccgccccccgccccaactcccacctcctccccggcgggcggccgagg
gtggacgcggcgacgagccgcgggcaagagccggagcccgcgcctggaggcggggtggag
ggggtcggagctcgcggcgttgcagtgaaacttttcgtccaacttctgggttgttcccgc
tccggaggagccgtggtccgcgccggggcagccgagccgagcggaaccaggagaagtgct
agctcgggccgggaggagccgcagtcggaggagggggaggaggaagaagaagagaaggaa
gaggagagggggccgcggtggcgacttggagctcggaagccgggctcatggacgggtgag
gcggctgtgtgcgcagacagtgctccagccgcgcgcgcgccccaggccctggcccgggcc
tcggcttcgggaggaagaggagaccgcctaggcgccgaagagagcgggccgccccgcagc
ccgagccggagagggagcgcgagccgcgccggctccggccgggcctccgaaaccatgaac
tttctgctctcttgggtgcattggagccttgccttgctgctctacctccaccatgccaag
tggtcccaggctgcacccatggcagaaggagagcacaaaccccacgaagtggtgaagttc
atggatgtctaccagcgcagctactgccgtcccattgagaccctggtggacatcttccag
gagtaccctgacgagatcgagtacatcttcaagccatcctgtgtgcccctgatgcggtgt
gggggctgttgtaatgatgagggcctggagtgcgtgcccactgaggagttcaacatcacc
atgcagattatgcggatcaaacctcatcaaggccagcacataggggagatgagtttccta
cagcacagcaaatgtgaatgcagaccaaagaaagatagagcaaggcaagaaaaaaaatca
gttcgaggaaagggaaaggggcaaaaaagaaagcgcaagaaatcccggtataaaccctgg
agcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcag
acgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagtta
aacgaacgtacttgcagatgtgacaagcccaggcggtga

DBGET integrated database retrieval system