KEGG   Enhydra lutris kenyoni (northern sea otter): 111147733
Entry
111147733         CDS       T05871                                 

Definition
(RefSeq) serum response factor
  KO
K04378  serum response factor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04022  cGMP-PKG signaling pathway
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111147733
   04022 cGMP-PKG signaling pathway
    111147733
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111147733
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111147733
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111147733
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    111147733
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 111147733
NCBI-ProteinID: XP_022359662
UniProt: A0A2Y9JF31
LinkDB
Position
Unknown
AA seq 508 aa
MLPSQAGAAAALGRGSALGGSLNRTPTGRPGGGGGGGTRGANGGRVPGNGAGLGPGRLER
EAAVAATTTPAPTAGALVYSGSEGDSESGEEEELGAERRGLKRSLSEMELVGGPEAAAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKQAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLADGSLTVLNAFSQAPSTMQVSHSQVQEQGGVPQVFLTAPSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDAAHSAKSD
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgttaccgagccaagctggggccgccgcggcgctgggccggggctcggccctgggaggc
agcctgaaccggaccccgacggggcggccgggaggtggcggcggcggcgggactcgcggg
gctaacgggggccgggttcccgggaacggcgcggggctcgggccgggccgcctcgagcgg
gaggctgcagtggcagcgacaaccaccccggcgcccaccgcgggggccctagtctacagc
ggcagcgagggcgactcggagtcgggcgaggaggaggagctgggcgcggagcggcgcggc
ctcaagcggagcctgagcgagatggagctcgtcggtgggcccgaggcggcggcggcggcc
actggaggctatgggccggtgagtggcgcggtgagcggggccaagccgggtaagaagact
cggggccgcgtgaagatcaagatggagttcatcgacaacaaactgcggcgctacacgacc
ttcagcaagaggaagacaggcatcatgaaaaaggcctatgagctgtccacgctgacaggg
acacaggtgctgttgctggtggccagtgaaacaggccatgtgtatacctttgccacccgc
aaactgcagcccatgatcaccagtgagactggcaaggcactgattcagacctgcctcaac
tcgccagactctccaccccgctcagaccccaccacagaccagagaatgagtgccacgggc
tttgaagaaacagacctcacctaccaggtgtcggagtccgacagcagtggggagaccaag
gacacactgaagcaggcgttcacggtcaccaacctgccgggtaccacctccaccatccaa
acagcacccagcacctctaccaccatgcaagtcagcagcggcccctccttccccatcacg
aactacctggcaccagtgtctgctagcgtcagccccagcgctgtcagcagtgccaacgga
actgtgctgaagagtacaggcagcggccccgtctcctctgggggcctcatgcagctgcct
accagcttcaccctcatgcctggtggggcagtggcccagcaggtcccagtgcaggccatt
caggtgcaccaggccccgcagcaagcgtctccctctcgagacagcagcacagacctcacg
cagacctcctccagcgggacagtgacattgcctgccaccatcatgacgtcatctgtgccc
acaactgtgggtggccacatgatgtaccctagtccccatgcggtgatgtacgcacccacc
tcgggcttggctgatggcagcctcaccgtgctcaatgccttctcccaggcgccatccacc
atgcaggtgtcccacagccaggtccaagagcaaggtggcgttccccaggtgttcctcaca
gcgccgtctgggacagtgcagatccctgtttctgcagttcagcttcaccagatggctgtg
atagggcagcaggctgggagcagcagcaacctcaccgagttacaggtggtgaacctggac
gccgcccacagcgccaagagtgactga

DBGET integrated database retrieval system