KEGG   Enhydra lutris kenyoni (northern sea otter): 111147734
Entry
111147734         CDS       T05871                                 

Definition
(RefSeq) serine/threonine-protein kinase pim-1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111147734
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111147734
   05206 MicroRNAs in cancer
    111147734
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111147734
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111147734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111147734
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111147734
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   111147734
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 111147734
NCBI-ProteinID: XP_022359663
UniProt: A0A2Y9JF77
LinkDB
Position
Unknown
AA seq 439 aa
MQRPWWRRRPERTWRPRRRRWRDRQQQQQLQALSAVALPHEPHEPPTPPPSALPDPAGVS
ASRQPRQRPQSSSDSPSAFRASRSRSRNATRSLSPSLRHSHRHNPSPSSCCSSSRHSSYA
DTLEVGMLLSKINSLAHLRAAPCNDLHGTKLAPGKEKEPLESQYQVGPLLGSGGFGSVYS
GIRVADNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPD
SFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHSCGVLHRDIKDENIL
IDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYD
MVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPSFEEIQNHPWMQDVL
LPQETAEIHLHSLSPGPSK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcagcggccgtggtggcggaggaggcccgagaggacttggcggccccggcggcggcgg
tggcgggaccggcagcagcagcagcagctacaagctctcagtgccgtggcgctgccgcac
gagccccacgagccgcccaccccgccgccctcggcgctgcctgaccccgccggcgtgtcc
gccagccgccagccccggcagcgcccccagtcgtcctccgactcgccctcggccttccgc
gccagccgcagccgcagccgcaacgccacccgcagcctcagccccagccttaggcacagc
caccggcacaaccccagccccagctcctgctgcagctcctccagacacagttcttacgcc
gacaccctggaggttgggatgctcttgtccaaaatcaactcgcttgcccacctgcgcgcc
gcgccctgcaacgacctgcacggcaccaagctggcgcccggcaaggagaaggagcccctg
gagtcgcagtaccaggtgggcccgctactgggcagcggcggcttcggctcggtctactca
ggcatccgtgtcgccgacaacttgccggtggccatcaagcacgtggaaaaggaccggatt
tccgactggggagagctgcccaatggcactcgagtgcccatggaagtggtcctgctgaag
aaggtgagctcgggcttctccggcgtcattaggctcctggactggttcgagaggcccgac
agtttcgtcttgatcctggagaggcccgagccggtgcaagacctcttcgactttatcacg
gaaaggggggccctgcaggaggagctggcccgcagcttcttctggcaggtgctggaggct
gtgcggcactgccacagctgcggggtgctccaccgcgacatcaaggacgagaacatcctc
atcgacctcaatcgcggcgagctcaagctcatcgacttcgggtcgggggcacttctcaag
gacaccgtctacacggacttcgatgggacccgggtgtatagccctccagagtggattcgc
tatcatcgctaccacggcaggtcggcagccgtctggtctctggggatcctgctgtatgac
atggtctgtggagatattccttttgagcacgatgaggagatcatccggggccaagttttc
ttcaggcagagggtctcttcagagtgtcagcatctcattagatggtgcttggccctgaga
ccatcagaccggccatccttcgaagaaatccagaaccatccctggatgcaagatgtcctc
ctgccccaggaaacagctgagatccatctgcacagcctgtcaccagggcccagcaaatag

DBGET integrated database retrieval system