KEGG   Enhydra lutris kenyoni (northern sea otter): 111148116
Entry
111148116         CDS       T05871                                 

Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04915  Estrogen signaling pathway
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05223  Non-small cell lung cancer
elk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111148116
   04012 ErbB signaling pathway
    111148116
   04014 Ras signaling pathway
    111148116
   04151 PI3K-Akt signaling pathway
    111148116
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    111148116
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148116
  09162 Cancer: specific types
   05210 Colorectal cancer
    111148116
   05212 Pancreatic cancer
    111148116
   05225 Hepatocellular carcinoma
    111148116
   05214 Glioma
    111148116
   05211 Renal cell carcinoma
    111148116
   05215 Prostate cancer
    111148116
   05223 Non-small cell lung cancer
    111148116
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111148116
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 111148116
NCBI-ProteinID: XP_022360240
UniProt: A0A2Y9JR09
LinkDB
Position
Unknown
AA seq 159 aa
MVPSAGQLVLFALGLLLAVCQALENSTSALSDPPVAAAVVSHFNDCPDSHSQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIACVLI
HCCQVRKHCEWCQALICRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgtcttgttcgcgctgggtctcctgttggctgtgtgc
caggccctggagaacagcacatctgccctgagtgacccgcctgtggctgcagctgtggtg
tcccactttaatgactgcccagattcccacagtcagttctgcttccatggaacctgcagg
tttttggtgcaggaagacaagccagcatgcgtctgccattctgggtacgtgggtgcgcgg
tgtgagcatgctgacctcctggccgtggtggccgccagccagaagaagcaggccatcacc
gccttggtggtggtctccatcgtggccctggctgtcctcatcatcgcatgtgtgctgata
cactgctgccaggtccgaaaacactgtgagtggtgccaggctctcatctgccggcatgag
aagcccagcgccctgctgaagggaaggactgcttgctgccactccgaaacagtggtctga

DBGET integrated database retrieval system