KEGG   Enhydra lutris kenyoni (northern sea otter): 111148270
Entry
111148270         CDS       T05871                                 

Definition
(RefSeq) adenomatous polyposis coli protein isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04310  Wnt signaling pathway
elk04390  Hippo signaling pathway
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04810  Regulation of actin cytoskeleton
elk04934  Cushing syndrome
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05217  Basal cell carcinoma
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111148270
   04390 Hippo signaling pathway
    111148270
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111148270
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111148270
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148270
   05206 MicroRNAs in cancer
    111148270
  09162 Cancer: specific types
   05210 Colorectal cancer
    111148270
   05225 Hepatocellular carcinoma
    111148270
   05226 Gastric cancer
    111148270
   05217 Basal cell carcinoma
    111148270
   05213 Endometrial cancer
    111148270
   05224 Breast cancer
    111148270
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111148270
   05022 Pathways of neurodegeneration - multiple diseases
    111148270
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111148270
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111148270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111148270
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111148270
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:elk04812]
    111148270
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111148270
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111148270
Cytoskeleton proteins [BR:elk04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     111148270
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 111148270
NCBI-ProteinID: XP_022360445
UniProt: A0A2Y9JRK4
LinkDB
Position
Unknown
AA seq 2872 aa
MYASLGSGPVGALPASAPPSTLGSWSSGSGSGCVPQERKRPGGVRTSGRGASVWQEVLKQ
LQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGEC
SPVPMGSFPRRGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRID
SLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRVTRIQQIEKDILR
IRQLLQSQATEAERSSQNKHEAGSHEAERQNEGQGVAEINMATSGSGQGSTTRMDHETAS
VLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQS
GCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLL
EQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELG
RKATRGISSQELGQGLSGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGD
VANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKAL
MECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQANTLAII
ESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNP
KDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSL
HVRKQKALEAELDAQHLSETFDNIDNLSPKASHRNKQRHKQSLYNDYVFDTNRHDDNRSD
NFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGISLGNYHPATENSGT
SSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSTTELHCGTDERNALRRSSTAHTHA
NTYNFSKSEGSNRTCPVTYANLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDES
KFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARP
KHIIEDEIKQSEQRQSRSQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGASGSET
NRVGSNHGINQNVNQSLCQEDDYEDDKPTNYSERYSEGEQHEEEERPTNYSIKYNEEKHH
VDQPIDYSLKYATDISSSQKPPFSFSKNSSGQSTKTEHLSSSSENTSTPSANAKRQNQHH
PSSAQSRNGQTPKATSCKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDQA
TQETDSANTLQIAEIKENSGTRTTEDSVSEVPTVSQHIRTKSSRLQASGLSAESTRHKAV
EFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSG
MVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTVQTKREVPKNKAPAVEKRESGPKQAAV
NAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQEND
NGNETESEQPEEANENQEKETEKPTDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAK
KPAQTASKLPPPVARKPSQLPVYKLLPSQNRLQAQKHVSFTPGDDMPRVYCVEGTPINFS
TATSLSDLTIESPPNELAAGEGVRPGAQSSEFEKRDTIPTEGRSTDEAQRGKTPSVTIPE
LDDSKTEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASMSSSGANKNQLDGKKKKP
TSPVKPIPQNTEYRTRVRKNADSKNNLNAERTFSDNKDSKKQNLKNNSKDFNDKLPNNED
RVRGSFTFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKENKESEA
KVTSHTELTTNQQSANKTQAVTKHPINRGQSKSLLQKQSTFPQSSKDIPDRGAATDEKLQ
NFAIENTPVCFSRNSSLSSLSDIDQENNNNKENEPIKETEPPNSQGEPSKPQASGYAPKS
FHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKGDNEKHSPRNMSGI
LAEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSD
SDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESENKGIKGG
KKVYRSLLTGKVRSNSEISNQMKQSLQANMPSISRGRTMIHIPGVRNSSSSTSPVSKKGP
PLKTPASKSPSEGQTATTSPRGPKPSVKSELSPVTRQTSQPAVANKGPSRSGSRDSTPSR
PAQQPLSRPMQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGR
QMSQQNLTKQTGLSKNGSSIPRSESASKGLNQMNNSNGSNKKVELSRMSSTKSSGSESDR
SERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDM
SLSTHSSVQSGGWRKLPPNLSPTIEYNDGRPVKRHDIARSHSESPSRLPINRSGTWKREH
SKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGAKQTKENQVSTKGT
WRKIKESEISPTNSTSQTTSSGAANGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRS
GRSPTGNTPPVIDTVSEKGNPNAKDAKDNQGKQNVGNGSAPVRTMGLENRLNSFIQVDAP
DQKGTEAKPGQSNPVPASETNESSVAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPR
KSSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV
NT seq 8619 nt   +upstreamnt  +downstreamnt
atgtacgcctctctgggctcgggtccggtcggcgctttgcctgcttctgcaccaccctct
actctagggtcctggagctccggcagcggcagcggctgtgtcccccaggagaggaagcgc
ccaggcggcgtccgtacttctggccgcggggcgagcgtctggcaggaagtacttaaacaa
ctacaaggaagtattgaagatgaggctatggcttcctctggacagattgatttattagag
cgtctcaaagaacttaacttagatagcagtaatttccctggagtgaaactacggtcaaaa
atgtccctccgttcttatgggagccgtgaaggatctgtatctagtcgttcaggagagtgc
agtcctgttcctatgggttcgtttccaagaagagggtttgtaaacggaagcagagaaaat
accggttatttagaagaacttgagaaagagagatcattacttcttgctgatcttgacaaa
gaagaaaaggaaaaagactggtattacgctcaacttcagaatctcaccaaaagaatagat
agtctccctttaaccgaaaatttttccttacaaacagatatgaccagaagacaattagaa
tatgaagcaaggcaaatcagagttgcaatggaagaacaactaggtacttgccaggatatg
gaaaaaagagcacagcgaagagtaaccagaattcaacaaatagagaaggatatacttcgt
atacgacaacttttacagtcccaagcaacagaagcagagaggtcatctcagaacaagcat
gaagctggctcacatgaagctgagcggcagaatgaaggtcaaggagtggcagaaatcaac
atggcaacttctggaagtggtcagggttcaactacacgaatggatcatgaaacagccagt
gttttgagttctagtagcacacactctgctcctcgaaggttgacaagtcacctgggaacc
aaggtggaaatggtgtattcattgttgtcaatgcttggtactcatgataaggatgatatg
tcacgaactttgctagctatgtctagctcccaagacagctgtatatccatgcgacagtct
ggatgtcttcctctcctcatccagcttttacatggcaatgacaaagactctgtgttgttg
ggaaattcccggggcagtaaagaggctcgggccagggccagtgcagcacttcacaacatc
attcactcacagcctgatgacaagagaggcaggcgtgaaatccgagtccttcatcttttg
gaacagatacgagcttactgtgaaacctgttgggagtggcaggaagcccatgaacaaggc
atggaccaggacaaaaatccaatgccagctcctgttgaacatcagatctgtcctgctgtg
tgtgttttaatgaaactttcatttgatgaagaacatagacatgcgatgaatgaacttggt
aggaaggctacccggggcatttcatcacaggagctagggcaggggctttcagggggacta
caggccattgcagaattattgcaagtggactgtgaaatgtatgggctaactaatgaccac
tacagtattacattaagacggtatgctggaatggctttgacaaacttgacttttggagat
gtggccaacaaggctacactctgctctatgaaaggctgcatgagagcgcttgtggcccaa
ctaaaatctgaaagtgaggacttacagcaggttattgcaagtgttttgaggaatttgtct
tggcgagcagatgtaaatagtaaaaagacattgcgtgaagttggaagtgtgaaagcattg
atggaatgtgctctagaagttaaaaaggaatcaaccctcaaaagcgtattgagtgcctta
tggaacttgtctgcacactgcactgagaataaagctgacatatgtgctgtagatggtgcg
ctagcatttctggtcggcactctcacttaccgaagccaggcaaatacgttagccattatt
gaaagtggaggtgggatactacggaacgtgtccagcttgatagctacaaatgaggaccac
aggcaaatcctaagagagaacaactgcctgcaaaccttattacaacacttgaaatctcac
agtttgacaatagtcagtaatgcatgtggaaccttgtggaatctctcagcaagaaatcct
aaagaccaagaagcattatgggacatgggggcagtcagcatgctcaaaaacctcatacat
tcaaagcacaaaatgattgctatgggaagcgctgcagctttaaggaatctcatggcaaat
agacctgcaaaatataaggatgccaatattatgtctcctggttcaagcttgccatctctt
catgtcagaaaacaaaaagccctagaagcagaattagatgctcagcatttatcagaaact
tttgacaatattgacaatttaagtcccaaggcatctcatcgtaataagcaacgacacaag
caaagtctctataatgactatgtttttgacaccaatcgacatgatgataataggtcagac
aattttaatactggaaatatgactgtcctttcaccatatttaaataccacagtgttgcct
agctcttcttcctcaagaggaagtttagacagttctcgttctgaaaaagatagaagtttg
gagagagaacgaggaatcagcctaggcaactaccacccagcaacagaaaattcaggcact
tcttcaaagcgaggtttgcaaatttccaccactgcagcccagattgccaaagtcatggaa
gaagtatcagccattcacacctcccaggaagacagaagttctgggtctaccaccgagtta
cattgtgggacagatgagaggaatgcactaagaagaagctctactgcccacacacatgca
aacacttacaacttcagcaagtcagaaggttcaaataggacatgtcctgtgacttatgct
aacttggaatataagagatcttcaaatgatagtttaaacagtgtcagtagtagtgatggt
tatggtaaaagaggtcagatgaagccttccattgaatcctattctgaagacgatgaaagt
aaattttgcagctatggtcaatatccagctgacctggcccataaaatacatagcgcaaat
cacatggatgacaatgacggagaactagatacacccataaattatagtcttaaatattca
gatgagcagttaaactccggaaggcaaagcccttcacagaatgaaagatgggcaagaccc
aaacatataatagaagatgaaataaaacaaagcgagcagagacaatcaagaagtcaaagc
acaacttaccccgtatataccgagagcactgacgataaacacctcaagttccaaccacat
tttggacagcaggaatgtgtttccccatataggtcaagaggagccagtggttcagaaaca
aatcgagtaggttctaatcatggaattaatcaaaatgtaaaccagtctttgtgtcaggaa
gacgactatgaagatgataagccaaccaactacagtgaacgttactccgagggagagcag
catgaggaagaagaaagaccaacaaattatagcataaaatacaacgaagaaaaacatcat
gtggatcagcctattgattatagtttaaaatatgccacagacatttcttcttcccagaaa
ccaccattttcattctcaaagaattcatctggacagagcactaaaactgaacacctctct
tcaagcagtgagaatacgtccacaccttcagctaatgccaagaggcagaatcagcaccac
ccaagttcagcacaaagcagaaatggtcagacccccaaagccacctcctgcaaagttccc
tccatcaaccaagaaacaatacagacttactgtgtagaggataccccgatttgtttttca
cgctgcagttcattatcatctttgtcatcagctgaagatgaaataggatgtgatcaggca
acccaggaaacagattctgctaatactctacaaatagcagaaatcaaagaaaacagtggg
actagaacaacagaagattctgtgagtgaagttccaaccgtgtcacagcatattcgaacc
aaatccagcagacttcaggcttctggtttatctgcagaatcaaccaggcacaaagctgtt
gaattttcttcaggggccaaatccccatcaaaaagtggtgctcagacacctaaaagtcca
ccggagcactatgttcaggagactccactcatgtttagccgatgtacctcagtcagttca
ctcgatagctttgagagtcgttcgattgccagctctgttcagagtgaaccctgcagtgga
atggtaagtggcattataagccccagtgaccttccagatagccccggacaaaccatgcca
ccaagcagaagtaagacccctccccctccgcctcagacagttcagaccaagcgagaggtg
cctaaaaacaaagcccctgctgtggaaaagagggagagtggacctaagcaagctgctgta
aacgctgccgtacagagagtccaggttcttccagatgctgacactctgttacattttgcc
acagaaagtactccagatggattttcttgttcctctagcctgagtgctctgagcctcgac
gagccatttatacagaaagatgtggaattaagaataatgcctccagttcaggaaaatgac
aatgggaatgaaactgaatctgagcagcctgaagaagcaaatgaaaaccaggaaaaagag
acggaaaaacctaccgactccgaaaaagacctcttagatgactcagatgatgatgatatt
gaaatactagaagaatgtattatttctgccatgccaacaaaatcttcacgcaaagccaaa
aaaccggcccagactgcttcaaaattacctccccctgtggcaaggaaaccaagtcaactt
cctgtgtacaaacttcttccatcacaaaacaggttacaagcacaaaagcatgttagtttt
acaccaggagatgatatgccacgggtatattgtgtagaagggacacctataaacttttct
acagctacatctttaagtgatctaacgatagaatctcctcccaatgagttagctgctggg
gaaggggttagaccaggggcacagtcaagtgaattcgaaaaacgagataccattcctaca
gaaggcagaagtacagatgaggctcaaagaggaaaaaccccatctgtaacaatacctgaa
ctggatgatagtaaaacagaagaaggtgatattcttgcagaatgcattaattctgctatg
cccaaaggaaaaagtcacaagcccttccgtgtgaaaaagataatggaccaagtccagcaa
gcatctatgtcttcatctggagctaacaaaaatcaattagatggtaagaaaaagaaacct
acttcaccagtaaaacctataccacaaaatactgagtataggacacgtgtaagaaaaaat
gcagactcaaaaaataatttaaatgctgaaagaactttctcagacaacaaagattcaaag
aaacagaacttgaaaaataattccaaggacttcaatgataagctaccaaataacgaagat
cgagtcagaggaagttttacttttgattcacctcatcactacacacctattgaaggaact
ccatactgtttttcacgaaatgattctttgagttctctagattttgatgatgatgatgtt
gacctttccagagaaaaggctgaattaagaaaggggaaagaaaataaggaatcagaagct
aaagttaccagccacacagaactaaccactaaccaacagtcagctaataagacacaggct
gttacaaaacatccaataaatcgaggtcagtctaaatccttgctgcagaagcagtccact
tttccacagtcatccaaagacataccagacagaggggcagcaactgacgaaaaattacaa
aactttgctattgaaaatacaccagtatgcttttctcgaaactcctctctaagttccctt
agtgacattgatcaagaaaacaacaataacaaagaaaatgaacctatcaaagagacagag
ccccctaactcacagggagaaccaagtaaacctcaggcatcaggttacgctcctaaatca
tttcacgttgaagatacccctgtttgtttctcgagaaacagttctctcagttctcttagt
attgattctgaagacgacctgttgcaagaatgtataagttctgcaatgccaaaaaagaaa
aagccttcaagactcaagggtgataatgaaaagcatagccccagaaatatgagtggcata
ttagcagaagatttgacactcgatttgaaagatatacagagaccagattcagaacatggt
ttatccccagattcagaaaattttgattggaaagctattcaggaaggtgcaaattccata
gtaagtagtttacatcaagctgctgctgctgcctgtttatctagacaagcttcatctgac
tcagattccatcctttcactgaaatcaggaatctctctgggatcaccatttcatcttaca
cctgatcaagaggaaaaaccatttacaagtaataagggcccacgaatactaaaacctggg
gagaagagcacattggaaactaaaaagatagaatccgaaaataaaggaatcaaaggaggg
aaaaaagtttatagaagtttacttactggaaaagttcgatctaattcagagatttcaaac
caaatgaaacagtcccttcaagcaaacatgccttccatctctcgaggccggacaatgatt
catattccaggagttcgaaatagctcttcaagtacaagtccagtttctaagaaaggccca
cctcttaagactccagcctccaaaagccctagcgaaggtcagacagccaccacttctcct
agaggacccaagccatcagtgaagtcagaattaagccctgtaaccaggcagacatcccaa
ccagctgtggcaaataaagggccttctagatcaggatctagagattccactccttcaaga
cctgcccaacaaccattaagtagacctatgcagtctccagggcgaaactcaatttctcct
ggtagaaatggaataagtcctcctaacaaattatctcagttgccaaggacttcatcccct
agtactgcttcgactaagtcctcaggttctgggaagatgtcttatacatctccaggcaga
cagatgagccaacagaaccttaccaaacaaacaggtttatccaagaatggcagtagtatc
ccaagaagtgagtctgcctccaaaggactaaatcagatgaataatagcaatggatccaat
aaaaaggtggaactttctagaatgtcttcaacaaagtcaagtggaagtgaatctgatagg
tcagagagacccgtattagtacgccagtcaactttcattaaagaagctccaagcccaacc
ctaaggagaaaactggaggagtctgcttcatttgaatctctttctccatcttctagacca
gattctcccactaggtcccaggcacagactccggttttaagtccttcccttcctgatatg
tctttgtccacacattcgtctgttcagtctggtggatggcgaaaactccctcctaatctc
agtcccaccatagagtataatgatggaagaccagtaaagcgccatgatatagcacgctcc
cattctgaaagtccttctagacttccgattaatagatcagggacctggaaacgtgagcac
agcaagcattcatcatcccttcctcgagtaagcacttggagaagaactggaagttcatcc
tcaattctttctgcttcatcagagtccagtgaaaaagcaaaaagtgaggatgaaaaacat
gtgaactcaatttcaggagccaaacaaactaaagaaaaccaagtatccacaaaaggaaca
tggagaaaaataaaagaaagtgagatttctcccacaaatagtacctctcagaccacttcc
tcaggtgctgcaaatggtgctgaatcaaagactctaatttatcaaatggcacctgctgtt
tctaaaacagaggatgtttgggtgagaattgaggactgtccgattaacaaccctagatcc
ggaagatctccaacaggaaatactccccctgtgattgacactgtttcagaaaagggaaat
ccaaatgctaaagatgcaaaagataatcagggaaagcaaaatgtgggtaatggcagtgct
cccgtacgcaccatgggtttggaaaaccgcctgaactcctttattcaagtagatgcccca
gaccaaaaaggaactgaggcaaaaccgggacaaagtaatcctgtccctgcatcagagaca
aatgagagctctgttgctgagcgtacaccattcagttctagcagctcgagcaagcacagt
tcacctagtgggactgtggctgccagagtgactcctttcaattataatccgagccctagg
aaaagcagcgcagatagcacttcagcccggccgtctcagatcccgacgccagtgaataac
aacacgaagaaacgagattcaaaaactgacagcacagaatccagtggaactcaaagtcct
aagcgccattctgggtcttaccttgtgacatctgtgtaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161627
Entry
111161627         CDS       T05871                                 

Definition
(RefSeq) adenomatous polyposis coli protein 2 isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04310  Wnt signaling pathway
elk04390  Hippo signaling pathway
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04810  Regulation of actin cytoskeleton
elk04934  Cushing syndrome
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05217  Basal cell carcinoma
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111161627
   04390 Hippo signaling pathway
    111161627
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111161627
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111161627
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161627
   05206 MicroRNAs in cancer
    111161627
  09162 Cancer: specific types
   05210 Colorectal cancer
    111161627
   05225 Hepatocellular carcinoma
    111161627
   05226 Gastric cancer
    111161627
   05217 Basal cell carcinoma
    111161627
   05213 Endometrial cancer
    111161627
   05224 Breast cancer
    111161627
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111161627
   05022 Pathways of neurodegeneration - multiple diseases
    111161627
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111161627
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111161627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111161627
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111161627
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:elk04812]
    111161627
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111161627
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111161627
Cytoskeleton proteins [BR:elk04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     111161627
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC Suppressor_APC Arm Arm_APC_u3 APC_r SAMP bZIP_1 Wtap Sec7_N Herpes_BLRF2 Sec2p HALZ
Other DBs
NCBI-GeneID: 111161627
NCBI-ProteinID: XP_022381091
UniProt: A0A2Y9L584
LinkDB
Position
Unknown
AA seq 2395 aa
MALPTSVAVCRSAGHAAWPRGQPCSSPHQALLWGLTPQTGWEGWDFGQGPPLPRPLGEPS
DLWPQALQELKMASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEV
LKHLQGKLEQEAGVLVSLGQTDVLEQLKALQMDITSLYNLKFQPPALSPEPAARTPEESP
VHGSGPSKDSFGELSRATVRLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDEL
PHVETQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDQELLSA
QDRVPQTEPQALLAVKSVPVEEDPETEVPTHPDDGVPQPGNSKVEVVFWLLSMLATRDQE
DTARTLLAMSSSPESCVAMRRSGCLPLLLQILHGAEAGAGSPGAPGAKDARMRANAALHN
IVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQGRDGADGGGNGGAPVPIEPQICQA
TCAVMKLSFDEEYRRAMNELGGLQAVADLLQVDYEMHKMTRDPLNLALRRYAGMTLTNLT
FGDVANKATLCARRGCMEAIVAQLASESEELHQVPGQCGSRSALWGVPPPEAFLLARLPL
PWVWGIPSSLCSAPPGTGVEALVALGPHCPFSAPAQVVSSILRNLSWRADINSKKVLREV
GSMTALMQCVLRASKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTHKCQS
NSLAIIESGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWN
LSARSPRDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQTTATAVSP
GACAPSLYVRKQRALEAELDTRHLAQALDHLEKQGLPEAEADAASKKPLPPLRHLDGLAR
DYASDSGCFDDDEAPSLAAAAATAEPASPAVLSLFLGSPFLQGQALARAPPAPRSVPEAE
KEAGREVAVAARAKAKLALAVARIDRLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQ
SCSPCRRPEVRRPEAGSRAHPLLRLKAAHASLSNDSLNSGSTGDGRCPREHTRSCPLAVL
AEHREGSPSSQVRPSRLDLHLPGSQEPASRDGSAPDACVRTIRLSPTYRHVPLFEGNPRA
GMGSLAPGARKQAWLPMDGLSKVPEKLVAETVPLCLSRCSSLSSLSSAGRPGPSEAGDLD
SDSSLEGLEEAGPSKADLDGAWLGPGAASLPVAIPAPQRGRGLGVEDATPSSSSENCVQE
TPLVLSRCSSVSSLSSFESPSIASSVPSDPCSGLGSGTVSPSELPDSPGQTMPPSRSKTP
PLAPAPPGERESTQFSLQWESYVKRFLDIADRRERCRLPSELDAGSVRFTVEKPDENFSC
ASSLSALALHEHYVQKDVELRLLPPACPERGGGGGGPGMHFAGHRRRDEAGGCLEGPAAA
DQELELLRECLGAAVPARLRKVASALVPGRRALPVPVYMLVPAPARGEDSCADSADGTPV
TFSSATSLSDETLQGPPRDPPSGHSDRQKPAGCEAPARQATGHRHRAWGAGQSPGQARGV
GRSREGLELPLHRPSRAYKDQDVFRPSPGRGDGALQSLCLTTPTEEAVYCFYDNDSDEEP
SEAVVPPRRASAIPRAVKRERPAGRKEVQAAPKATPKATQAARAQPSLIADEMPPCYSLS
SSASSLSEPDPPEHPAGRPQALEPAVSKGPGAAGGRHGPPSPQVETGLLRRSVNSTVPRR
RFQASGPRRRKPQAAQPDKQPAEGPRERGDEAASSDHASDLDSVEWRAIQEGANSIVTWL
HQAAAAATHEASSGSDSILSGSGLSGSSTLQPTLHRKGRRLQAEGPVGSTARPEKRDSAL
AQHSTSGPEKLRGAQKTACRVPAVLRGRTVIYVPSPAPRAQPKSHPGTRVAPRKMGPPSP
AQPGAPAKTPSPGQQRSRSLHRPGKSSELAALSRPQRSATPPARLAKAPSSGSSPASPAS
QPPTRRPPPGAQAAGPLPGPGAALVPQTPTRALLSKQHKTQKSPVRIPFMQRPARRGPPA
LARAAPEPGPRGRAAAEGSPGARGGRLGLVRVASARSSGSGSSDRSGFQRQLTFIKESPG
LHRRRSGLSTPEAAPPASQGGSPRRSRPALPAVFLCSSRCDELRAAPRQVPAPQQALVAR
PRPSERPARRPSSESPSRLPVRTPAAPPEAVKRYASLPHISVARRPDGAAPGPSADAARR
SSDGEARPLPRVAAPGTTWRRIRDEDVPHILRSTLPATALPLMGAPSEEGPSGPPQRKTS
DAVVQTEDFAATKTNSSTSPSLESRGPPQASVSGPSTLTSSDADGLGPTKAPTSAPFVHE
GLGVAAGGFPASRHGSPSRSARVPPFNYVPSPMVAATTDLATEKAPTAAPASLLE
NT seq 7188 nt   +upstreamnt  +downstreamnt
atggctctgcccacatctgtcgctgtctgtcgctctgctggccatgctgcatggcctcgg
ggccagccctgcagcagtccacaccaggcactcctgtggggactcaccccccagactgga
tgggagggctgggactttggtcaggggccaccccttcctagacccttgggtgaaccttct
gacctgtggccccaggcgctccaggagctgaagatggcgagctccgtggcaccctatgag
cagctggtgcggcaggtggaggccttgaaggccgagaacagtcatctgaggcaggagctg
cgagacaattccagccacctgtccaagctagagacggagacgtccggcatgaaggaggtc
ctgaagcacttacagggcaagctggagcaagaggccggagtgctggtgtccttggggcag
acggatgtgctggagcagctgaaagccctgcagatggacatcaccagcctgtacaacctc
aagttccaacccccagccctaagccccgagcccgcggcgcggacccctgaagaaagtccc
gtccacggctctggaccctctaaggacagttttggggagctgagcagggctactgtccgg
ctgctggaggagctggaccgggaacggtgcttcctgttgaacgagatcgagaaggaggag
aaggagaagctctggtactactcgcagctgcagggcctgtccaagcgcctggacgagctc
ccgcacgtggagacgcagttctcgatgcagatggacctgatccggcagcagctggagttc
gaggcccagcacatccgctcgctgatggaggagcgcttcggcacctccgacgagatggtg
cagcgcgcgcagatccgcgcttcgcgcctggagcagatcgatcaggagctgctgtccgcc
caggaccgcgtgccgcagaccgagccccaggccctgctggcggtgaagtcagtgccggta
gaggaggacccggagactgaggtccccacgcaccctgacgatggtgtccctcagccgggc
aacagcaaggtggaggtggtcttctggttgctgtccatgctggcgacacgggaccaggag
gacacagcccgcaccctgctggcgatgtccagctcgccggagagctgcgtggcgatgcgt
cgctcggggtgtctgccgctgctgctgcagattctgcatggcgccgaggctggcgctggg
agccccggggcgccgggagccaaggatgcacgcatgcgcgccaacgcggcgctgcacaac
atagtcttctcgcagccggaccagggcctggcgcgcaaggagatgcgcgtcctgcatgtg
ttggagcagatccgggcctactgcgagacctgctgggactggctgcagggcagggacggc
gccgacggaggcggcaacggcggggcccccgtccccattgagcctcagatctgccaggcc
acctgtgccgtgatgaagctgtcctttgatgaggagtaccgccgtgccatgaacgagctg
ggtgggctgcaggccgtcgcggacttgctgcaggttgactacgagatgcacaagatgacg
cgggacccgctcaaccttgcccttcgccgctatgccggcatgaccctcaccaaccttacc
tttggggacgtcgccaacaaggcaacgctgtgtgcccgccggggctgcatggaggccatc
gtggcccagctggcttctgagagcgaggaactccaccaggtacctgggcagtgtggctcc
aggagcgccctgtggggtgtcccaccgcctgaggcctttctgctggccaggctccctctc
ccctgggtatggggcatcccctccagtctctgctcagctccacctggcacaggcgtggag
gctctggtggccttaggtccacattgccccttctctgccccggcccaggtggtgtccagc
atcctgcgcaacctgtcctggagggctgacatcaacagcaagaaggtgctgagggaggtc
ggcagcatgactgccctgatgcagtgtgttcttcgagcctccaaggagtccaccctgaag
agcgtgctcagtgccctgtggaacctgtcggcacacagcacggagaacaaggcggccatc
tgccaggtggacggtgccctgggcttcctggtgagcacactgacccacaagtgccagagc
aactccctggccatcatcgagagcggcggcggcatcctgcgcaacgtgtccagcctcatt
gccacccgggaggactacaggcaggtgctgcgggaccacaactgcctgcagacgctgctc
cagcacctgacatcgcacagcctgaccatcgtgagcaacgcctgcggcacgctctggaac
ctgtccgcccgcagcccgcgtgaccaagagctcctgtgggacctgggggccgtgggcatg
ctgcgcaacctggtgcactccaagcacaagatgatcgccatgggcagcgccgccgccctg
cgtaacctgctggcccaccgccccgccaagtaccagaccacagccaccgccgtctcccct
ggcgcatgcgctcccagcctgtacgtgcggaagcagcgggcgctggaggccgagctggac
acgcggcatctggcgcaggcgctcgaccacctggagaagcagggcctgccggaggcggag
gccgacgcagcctccaagaagcccctgccgcccctgcggcacctggacgggctggcccgg
gactacgcctccgactccggctgcttcgatgacgacgaggcgccctccctggccgctgca
gccgccaccgcggagcctgccagccccgcggtgctgtcgctcttcctggggagccccttc
ctgcaggggcaggcgctggcccgggccccgccagccccccgcagtgtgccagaggcagag
aaggaggccggcagggaggtggccgtggcggccagagccaaggccaagctggcgctggcg
gtggcacgaatcgacaggctagtggaggacatctccgccctgcacacctcgtcggacgac
agcttcagcctcagctctggggaccctgggcaggaagcgccacgtgaaggccgggcccag
tcctgctctccttgccggcggccggaggtcaggcggccagaggctggcagtcgggcccac
ccactgctgcggctcaaggctgcccacgccagcctctccaatgacagcctcaacagcggc
agcaccggtgacgggcgctgtccccgtgagcacacacggtcctgcccgctggccgtgctg
gccgagcaccgcgaggggtccccgagcagccaggtgcggcccagccggcttgacctccac
ctgccgggcagccaggagccggcgtcccgggacggctctgcccctgacgcctgtgtgcgc
accatcaggctgtcgcccacctaccggcacgtaccactcttcgagggcaaccccagggcg
ggcatggggtccctggcccccggagcccggaagcaggcctggctgcccatggatggcctg
agcaaggtgccggagaagctggtggcagagaccgtgccactgtgcctgtcgcgctgcagc
tccctgtcctcgctgtcctcggctggtcgcccaggccccagtgaggccggggacctggac
agtgactcatccctggaagggctggaggaggccggacccagcaaggctgacctggacggg
gcctggcttggccccggggctgcctccctgcccgtggccatcccggctccccagcggggc
cggggcctgggggtggaggacgccaccccgtccagctcctcggagaactgcgtgcaggag
acgccgctggtgctgagccgctgcagttcggtgagctccctgagcagcttcgagagcccg
tccatcgccagctccgtcccgagtgacccgtgcagcgggctgggcagcggcacggtcagc
cccagcgagctgcccgacagccccgggcagaccatgccacccagccgcagcaagacgccc
ccgctagcccccgcgccccccggcgagcgggagagcacccagttcagcctgcagtgggag
agctacgtgaagcgcttcctggacatcgccgaccgccgcgagcgctgccggcttccgtcc
gagctggacgcgggcagcgtgcgcttcaccgtggagaagccggacgagaacttctcctgc
gcctccagcctcagcgcgctggccctgcacgagcactacgtgcaaaaggatgtggagctg
cggctgctgcccccagcctgccccgagcgtggcggcggcggcggcggccccggcatgcac
tttgcagggcaccgccggcgggacgaggccggtggctgtctcgagggcccggcagccgct
gaccaggagctggagctgctgcgcgagtgcctgggggcggcagtccccgcccggctccgc
aaggtggcctcggcgctggtgcctggtcgccgcgcattgcccgtgcccgtctacatgctg
gtgccggcccctgcccggggggaggactcctgcgctgactctgctgacggcacgcccgtc
accttctctagtgccacctcgctcagtgacgagacactgcagggacctcccagggaccca
cccagcgggcactcggacaggcagaagcctgcaggttgcgaggccccggccaggcaggcc
acgggacacaggcacagggcgtggggtgcgggccagagcccagggcaggcccggggcgtg
ggcaggagcagggaggggctggagcttcccctccaccggccctcgagagcctacaaggac
caggatgtctttcgccccagcccgggccgcggggatggggcgctgcagtctctgtgcctc
acgacgcccaccgaggaagccgtgtactgcttctacgacaacgactcagacgaggagccc
tccgaggcggtggtgcccccgcggcgggcatctgccatcccccgggcggtaaagagagag
cgcccggctggcaggaaggaggtgcaggccgcacccaaggctacgcccaaggccacgcaa
gctgcccgtgcccagcccagcctcattgccgatgagatgccgccgtgctactccctgagc
tcctccgccagctcccttagtgagcccgacccccctgagcacccagcaggccggccccag
gctctcgagccagctgtcagcaaggggccaggcgctgcagggggtcgtcatggcccccca
agcccacaggtggagacagggctgctccggcgcagtgtcaactccacggtgcccaggcgc
cggttccaagcatcgggccctcggcgccgcaagccccaagccgcccagccagacaagcag
cctgcagaggggccccgggagcgcggggacgaggcggccagctctgaccatgcctccgac
cttgacagcgttgagtggcgcgctatccaggagggcgccaactccattgtcacgtggctg
caccaggcggcggccgcggccacccacgaggcctcatctgggtctgactccatcctgtcc
gggtcggggctgtcggggagctccaccctgcaacccacactgcacaggaagggacggcgg
ctgcaggcagagggcccggtgggcagcactgcgaggccggagaaacgggactcggccctg
gcccagcatagcaccagtggccccgagaagctgcgcggggctcagaagaccgcgtgcagg
gtgccagccgtgctccggggaaggaccgtgatctatgtgcccagcccggccccccgggcc
caacccaaaagccaccctggcacccgtgtggcaccgaggaagatgggacccccgagtcct
gcgcagccaggagcccccgccaagacccccagccccgggcagcagcggtctcgaagccta
caccggccgggcaaaagctcggagctggcggcgctgagccgtccacagaggagtgccaca
ccgcccgcccgcctggccaaggccccttcctcggggtcctcccccgcctctccggcctcc
cagccccctacaaggaggccgcccccaggcgcccaggcagcagggcctctccccggcccc
ggggcagctctggtgccccaaacacccacgcgggccctgctgtctaagcagcacaagacg
cagaagtcacctgtgcggatccccttcatgcagaggccagccaggcgggggccgccagcc
ctggccagggcagctccggagccgggtccccggggtcgggcggcagcggagggaagccct
ggcgcccgagggggccgcctgggcctcgtgcgtgtggcctctgcccgctccagcggcagc
gggtcgtccgaccgctccggtttccagcggcagctgacctttatcaaggagtccccgggc
ctgcaccgccgccgctcaggactgtccaccccagaggctgcaccccccgcctcccagggc
ggctcaccccgccgcagtcgacccgcgctgcccgccgtcttcctctgctcctcgcgctgc
gacgagctgcgggcagcccccaggcaggttccagccccccagcaagccctggtggccagg
cccaggcccagcgagcggcccgcccggcgcccgagctccgagagcccgtcccgcctgcct
gtccgcacgcccgccgccccacccgaggcggtcaagcggtacgcctccctgccgcacatc
agcgtggcccgcaggcccgacggggccgcccccgggcccagcgccgacgctgcccgccgc
agcagcgatggagaggcccggccactgccgagggtggcggcaccaggcaccacgtggcgt
cgcatccgggatgaggacgttccacacatcctgcggagcacgctgcctgccactgccctg
ccactgatgggcgccccgtccgaggagggccccagcggccccccacagcgcaagaccagc
gacgccgtggtccagacggaagactttgccgccactaagaccaactccagcacgtctccg
agtctggaaagcagggggcccccccaggcctcagtcagcggccccagcacactcaccagc
agcgatgcggacgggcttggccccaccaaagcgcccacctctgccccctttgtccatgag
ggcctgggggtggctgcagggggctttcccgccagccggcatggctctcccagccgctcg
gcccgtgtcccccccttcaactatgtgcccagccccatggtggcagccaccactgacttg
gccacagagaaagcccccactgctgcccctgccagcctcctggaatag

DBGET integrated database retrieval system