KEGG   Enhydra lutris kenyoni (northern sea otter): 111148276
Entry
111148276         CDS       T05871                                 

Definition
(RefSeq) ETS translocation variant 5
  KO
K15593  ets translocation variant 5
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk05202  Transcriptional misregulation in cancer
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111148276
  09162 Cancer: specific types
   05215 Prostate cancer
    111148276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111148276
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    111148276
SSDB
Motif
Pfam: ETS_PEA3_N Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 111148276
NCBI-ProteinID: XP_022360463
UniProt: A0A2Y9JHH6
LinkDB
Position
Unknown
AA seq 513 aa
MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYSY
CAYDRKPPSGFKPLTPPTTPLSPTHQNSLFPQPQATLPTSAHAPAAGPVPGVGPAPAPHS
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQSGVPGDTR
PNYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPGPPAHGFQSPMGIKQEPR
DYCVDSEVPNCQSSYIRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYR
EGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAM
NYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLNE
EDTLPLTHFEDNPAYLLDMDRCGSLPYAEGFAY
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggatgggttttatgatcagcaagtcccttttatggtcccagggaaatctcgatcagag
gaatgtagagggcggcctgtgattgacagaaagaggaagtttttggacacggatctggcc
catgattctgaagagctgtttcaggatctcagtcaacttcaagaggcttggttagctgaa
gcacaagttcctgatgatgaacaatttgtcccagatttccagtctgataacttggtgctt
cacgccccacctccaaccaagatcaaacgggagctgcacagcccctcctcggagctgtca
tcctgcagccacgagcaggctctcggtgctaactatggagaaaagtgcctctacagctat
tgtgcctatgatcggaagcctccctctgggttcaagccattaactcctcccaccaccccc
ctgtcacctacccatcagaactccctgttcccccaaccccaggcaactctgcccacctct
gcacacgcccctgcagcgggcccagtaccaggtgtgggccccgcccccgcccctcactcg
cttcctgaacctggaccacagcagcaaacctttgcggtcccccggccaccacatcagccc
ctgcagatgccaaagatgatgcctgaaaaccagtatccatcagaacagagatttcagaga
caactgtctgaaccctgccaccccttccctcctcaatcaggagttcctggagatactcgc
cccaattaccaccggcaaatgtcagaacctattgtccctgcagctcccccaccccctcag
ggattcaaacaagaataccatgatccactctatgaacatggggtcccaggcatgccaggc
cccccaggccccccagcacatgggttccagtcaccaatgggaatcaagcaggagccccgc
gattactgcgttgattcagaagtgcctaactgccagtcgtcctacatcagaggggggtat
ttctccagcagccatgaaggtttttcatatgaaaaagatccccggttgtactttgacgac
acttgtgttgttcctgagagactggaaggcaaagtcaaacaagagcccaccatgtatcgg
gaggggcccccttaccagaggcgaggttctcttcagctgtggcagttcctggttaccctg
cttgatgacccggccaatgcccacttcattgcctggacgggccgtggcatggagtttaag
ctgatagaacctgaggaggttgctcggcgctggggtatccaaaagaaccggccagccatg
aactatgacaagctcagccgttctctacgctattactacgaaaagggcatcatgcagaag
gtggccggggagcgatacgtctataaatttgtctgtgacccggatgcccttttctccatg
gccttccccgacaaccagcgtccgttcctgaaagcagagtctgagtgtcacctcaacgag
gaagataccctgccgctgacccactttgaagacaacccagcttacctcctggacatggat
cgctgtggcagcctcccctatgccgagggctttgcttactaa

DBGET integrated database retrieval system