KEGG   Enhydra lutris kenyoni (northern sea otter): 111148313
Entry
111148313         CDS       T05871                                 

Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03460  Fanconi anemia pathway
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    111148313
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148313
   05202 Transcriptional misregulation in cancer
    111148313
  09162 Cancer: specific types
   05210 Colorectal cancer
    111148313
   05212 Pancreatic cancer
    111148313
   05225 Hepatocellular carcinoma
    111148313
   05226 Gastric cancer
    111148313
   05214 Glioma
    111148313
   05216 Thyroid cancer
    111148313
   05220 Chronic myeloid leukemia
    111148313
   05217 Basal cell carcinoma
    111148313
   05218 Melanoma
    111148313
   05213 Endometrial cancer
    111148313
   05224 Breast cancer
    111148313
   05222 Small cell lung cancer
    111148313
   05223 Non-small cell lung cancer
    111148313
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111148313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:elk03400]
    111148313
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     111148313
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    111148313
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 111148313
NCBI-ProteinID: XP_022360520
UniProt: A0A2Y9JRT0
LinkDB
Position
Unknown
AA seq 870 aa
MDNTKEKSGNYKDDLLLRVGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEKSRDLNNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYQAVSTE
VKEILADYDPNFMAMSLDEAYLNITKHLQERQNWPEDKRKYFIKTGNSLENEKPGKETNK
LSEHERSISPLLFDDSPPDLQPQGNPLQVNSEEQNNPQLLQNSIVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQKALLSLLFSETSWHHFLHISLGLGSTHLTRDGERKSMSVER
TFNEISKAEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLRTEIDADFPHPLRLRLMGVRLSGFPSEEDKKHQQRSIIGFLQAGNPTL
SATGYMLEKTDKDQFQKPLEISHKKSFFDKKRSERKWSHQDTFKCEALGKPSLQTSYSVQ
VLKKKMNENLETSENSNNSQIFTCPICFREQRSISLEAFNKHIDACLDGHLISENSNVFS
CSHASSTEVNKKENVHPSFSLHGKQDYETHQKDSEISSVNCVELVETEDNPRKAKSIAGL
SDKHSKEECASLSSKSFNIDTRCHNSSSTVSLEDIGSLSRQESSKSYLHEEITDQPLVCP
VCNLEQKTSDLTLFNVHVDVCLNKGIIQELRMEKVSVANQPRESAQSTDNSGRVQKTATK
PKRPGLMTKDSASKKTKPNNPRHTLDVFFK
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggataacaccaaggaaaagagtggaaattacaaagatgatcttctgcttagagtggga
cttaatgataataaagccggaatggaaggattagataaagagaagattaacaaaattata
atggaagccacaaaagggtccagattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaattaccagccaacagctaagg
aaagcacaattacaggttgacagatttgcaatggaattggaaaagagccgggatctgaac
aatactatagtacacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgttgtctacttcgaat
taccatgcaaggaggtttggtgttcgtgcagccatgccaggatttattgctaaaagactc
tgcccacaacttattattgtgcccccaaactttgacaaataccaagctgtgagtacagag
gttaaggaaatacttgctgattatgatcccaattttatggctatgagtcttgatgaagcc
tacttgaatataacaaagcacttacaggaaagacaaaattggcccgaggacaaaaggaag
tatttcatcaaaacaggaaactctctagaaaatgagaaaccaggaaaagaaactaataaa
ctgagtgagcatgaacgttccatctctccactactttttgatgatagtcctcctgatttg
cagccccaaggaaatcctttacaagtgaactctgaagaacagaataatcctcaactactc
caaaattctattgtttttggaacatcagctgaggaagtagtaaaggaaattcgtttcaga
attgagcaaaaaacaacactgacagccagtgcaggaattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattctccccagcagacaa
gctgtgatggacttcatcaaggacttacctattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcgcttggaattattacttgtacagaactctaccaacagaag
gcattgctttctcttcttttctctgaaacatcttggcatcatttccttcatatttccctg
ggtctaggttcaacacacctgacaagggatggagaaaggaaaagcatgagcgttgagagg
acattcaatgaaataagtaaagcagaggaacaatatagcttgtgccaggaactttgcagt
gaacttgctcaagatctgcagaaagaaggactaaagggtagaactgttaccattaaactg
aagaatgtaaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctact
gcagaagaaatatttgctattgctaaagaattgctaagaacagaaattgatgctgatttt
ccacatcctttgagattaagacttatgggtgtacggttgtccggttttcccagtgaagaa
gataagaagcaccaacaaaggagcattattggcttcttacaggctggaaacccaactctg
tcagccactgggtatatgctagagaaaactgacaaagatcagtttcaaaaacctctagaa
atatctcataagaagagtttctttgataaaaagcgatcagaaaggaaatggagccatcaa
gacacatttaaatgtgaagctttgggtaaaccaagtttacagacatcatattcagttcaa
gttttaaagaagaagatgaatgagaatttagaaacgtcggagaattcaaataactctcag
atatttacctgcccaatttgctttagggagcaaagaagcatcagtctggaagcctttaat
aaacatatagatgcatgtcttgatggacatttgatcagtgaaaactccaatgtgttctca
tgttcacacgcttcctctacagaagttaacaagaaagaaaatgtacatccttcattctca
ctccatgggaagcaggattatgaaacccaccagaaggattcagaaatcagttcagtaaat
tgtgtagagctagtggagactgaagataacccacgtaaagcaaaaagtatagctggctta
agtgataagcacagcaaagaggaatgtgctagtctttcaagcaaatcatttaatattgac
acacggtgtcacaattcttcctctactgtttcattggaagatattgggtcattaagtcgg
caagaatcctccaagtcttatttacatgaagagataacagaccaacctctagtttgtcct
gtttgtaacctagagcaaaagacttcggatcttaccctgttcaatgtgcatgtggatgta
tgtttaaataaaggcattatccaggaactgagaatggaaaaagttagtgtagctaaccaa
cccagagaaagcgcccaaagtactgataactcaggcagagtgcagaagactgcaacaaaa
ccaaaaaggccaggattgatgacaaaggactcagcatcaaagaaaacaaaaccaaacaat
cccagacacactcttgatgtattttttaaatga

DBGET integrated database retrieval system