KEGG   Enhydra lutris kenyoni (northern sea otter): 111148592
Entry
111148592         CDS       T05871                                 

Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04060  Cytokine-cytokine receptor interaction
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04218  Cellular senescence
elk04350  TGF-beta signaling pathway
elk04390  Hippo signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05144  Malaria
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05220  Chronic myeloid leukemia
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05321  Inflammatory bowel disease
elk05323  Rheumatoid arthritis
elk05410  Hypertrophic cardiomyopathy
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111148592
   04350 TGF-beta signaling pathway
    111148592
   04390 Hippo signaling pathway
    111148592
   04068 FoxO signaling pathway
    111148592
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111148592
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111148592
   04218 Cellular senescence
    111148592
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148592
  09162 Cancer: specific types
   05210 Colorectal cancer
    111148592
   05212 Pancreatic cancer
    111148592
   05225 Hepatocellular carcinoma
    111148592
   05226 Gastric cancer
    111148592
   05220 Chronic myeloid leukemia
    111148592
   05211 Renal cell carcinoma
    111148592
  09163 Immune disease
   05323 Rheumatoid arthritis
    111148592
   05321 Inflammatory bowel disease
    111148592
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111148592
   05414 Dilated cardiomyopathy
    111148592
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111148592
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111148592
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111148592
   05161 Hepatitis B
    111148592
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111148592
   05144 Malaria
    111148592
   05145 Toxoplasmosis
    111148592
   05140 Leishmaniasis
    111148592
   05142 Chagas disease
    111148592
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111148592
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111148592
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 111148592
NCBI-ProteinID: XP_022360999
UniProt: A0A2Y9JN47
LinkDB
Position
Unknown
AA seq 410 aa
MHLQRALVVLALLNLATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSVM
THVPYQVLALYNSTRELLEEMQGEREDSCTQENTESEYYAKEIHKFDMIQGLAEHNELAV
CPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNLSSKRSEQRIELFQILRPDEHIAK
QRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENI
HEVMEIKFKGVDSEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRAL
DTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVL
GLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgcacttgcagagggctctggtggtcctggccctgctgaacttggccacggtcagcctc
tctctgtccacttgcaccaccttggactttggccacatcaagaagaagagggtggaagcc
attaggggacagatcttgagcaaactcagactcaccagtccccccgagccatcggtgatg
acccacgtcccctaccaggtcctggccctttacaacagcacccgggagctgctggaggag
atgcagggggagagggaggacagctgcactcaggaaaacaccgagtcggagtactatgcc
aaagaaatccataaattcgacatgatccaggggctggcggagcacaatgagctggccgtc
tgccccaaaggaatcacctccaaggttttccgcttcaacgtgtcctcagtggagaaaaat
ggaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaacctcagctccaag
cgcagcgagcagaggatcgagctcttccagattctccggcccgacgagcacattgccaaa
cagcgctacatcggcggcaagaatctgcccacgcggggcaccgccgagtggctgtctttt
gacgtcaccgacactgtgcgtgagtggcttctgcgaagagagtccaacttgggtctggaa
atcagcattcattgtccatgtcacacctttcagcccaatggagacatcctagaaaacatt
cacgaggtgatggaaatcaaattcaaaggtgtggacagtgaggacgatcatggccgtggg
gatctcggacgcctcaagaagcagaaggaccaccacaacccccacctcatcctcatgatg
attcccccgcaccggctggacaacccgggccaaggcgggcagaggaagaagcgggccctg
gacaccaattactgcttccgcaatctggaggagaactgctgtgtgcgccctctctacatt
gacttccgacaagatctgggctggaaatgggtccatgaacctaagggctactacgccaac
ttctgctcaggcccttgcccctacctccgcagcgcggacacaacccacagcacggtgctg
ggactgtacaacaccctgaatcctgaagcatccgcctcaccttgctgtgtgccccaggac
ttggagcccctgaccatcctgtactatgtcgggaggacccccaaggtggaacagctgtct
aacatggtggtcaagtcctgtaagtgtagctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151068
Entry
111151068         CDS       T05871                                 

Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04060  Cytokine-cytokine receptor interaction
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04218  Cellular senescence
elk04350  TGF-beta signaling pathway
elk04380  Osteoclast differentiation
elk04390  Hippo signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05144  Malaria
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05220  Chronic myeloid leukemia
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05321  Inflammatory bowel disease
elk05323  Rheumatoid arthritis
elk05410  Hypertrophic cardiomyopathy
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111151068
   04350 TGF-beta signaling pathway
    111151068
   04390 Hippo signaling pathway
    111151068
   04068 FoxO signaling pathway
    111151068
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111151068
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111151068
   04218 Cellular senescence
    111151068
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111151068
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111151068
   05206 MicroRNAs in cancer
    111151068
   05205 Proteoglycans in cancer
    111151068
  09162 Cancer: specific types
   05210 Colorectal cancer
    111151068
   05212 Pancreatic cancer
    111151068
   05225 Hepatocellular carcinoma
    111151068
   05226 Gastric cancer
    111151068
   05220 Chronic myeloid leukemia
    111151068
   05211 Renal cell carcinoma
    111151068
  09163 Immune disease
   05323 Rheumatoid arthritis
    111151068
   05321 Inflammatory bowel disease
    111151068
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111151068
   05414 Dilated cardiomyopathy
    111151068
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111151068
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111151068
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111151068
   05161 Hepatitis B
    111151068
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111151068
   05144 Malaria
    111151068
   05145 Toxoplasmosis
    111151068
   05140 Leishmaniasis
    111151068
   05142 Chagas disease
    111151068
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111151068
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111151068
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111151068
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111151068
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 111151068
NCBI-ProteinID: XP_022364515
UniProt: A0A2Y9K4C7
LinkDB
Position
Unknown
AA seq 442 aa
MHYCVLSAFLLLHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCARPSQVLCGYPDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGASTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgctcctgcatctggtcacggccgcgctcagc
ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactatcccgaaccc
gaggaagtgcccccggaggtgatttccatctacaacagcaccagggacttgctccaggaa
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacgccctctggctcagtgggtagcttgtgcgccaggccgtcccaggtgctctgt
gggtaccctgatgccatcccgcccactttctacagaccctacttcagaatcgtccgcttt
gacgtctcggcgatggagaagaatgcatccaacttggtgaaagccgagttcagagtcttt
cgtttacagaacccgaaagccagagtgcctgaacaacggatcgaactctaccagattctc
aaatccaaagatttaacatctccaacccagcgctacattgacagcaaagtcgtcaagacc
agagcagaaggcgaatggctttcctttgacgtgacggatgccgtccacgaatggctccac
cataaagacagaaacctgggatttaaaataagtttacactgtccctgctgcacctttgtg
ccatctaataattacatcattcccaataaaagtgaagagctagaagcaagatttgcaggt
attgatggcgcctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacacctcctgctaatgttgttgccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgctttggatgcagcatattgtttcagaaat
gtacaggataattgctgcctacgtccactttacattgatttcaaaagggatcttggatgg
aaatggatacatgaacctaaagggtacaatgccaacttctgtgctggagcgtgcccatat
ttatggagttcagacactcagcacagtagggttctcagcctatataataccataaatcca
gaagcatctgcttctccttgctgtgtgtcccaggatttagaaccgctcaccattctctac
tacatcggcaagacacccaagattgaacaactctctaatatgatcgtaaagtcttgcaaa
tgcagctaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161420
Entry
111161420         CDS       T05871                                 

Definition
(RefSeq) transforming growth factor beta-1 isoform X1
  KO
K13375  transforming growth factor beta-1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04060  Cytokine-cytokine receptor interaction
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04218  Cellular senescence
elk04350  TGF-beta signaling pathway
elk04380  Osteoclast differentiation
elk04390  Hippo signaling pathway
elk04659  Th17 cell differentiation
elk04672  Intestinal immune network for IgA production
elk04926  Relaxin signaling pathway
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05144  Malaria
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05220  Chronic myeloid leukemia
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05321  Inflammatory bowel disease
elk05323  Rheumatoid arthritis
elk05410  Hypertrophic cardiomyopathy
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111161420
   04350 TGF-beta signaling pathway
    111161420
   04390 Hippo signaling pathway
    111161420
   04068 FoxO signaling pathway
    111161420
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111161420
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111161420
   04218 Cellular senescence
    111161420
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111161420
   04672 Intestinal immune network for IgA production
    111161420
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111161420
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111161420
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161420
   05205 Proteoglycans in cancer
    111161420
  09162 Cancer: specific types
   05210 Colorectal cancer
    111161420
   05212 Pancreatic cancer
    111161420
   05225 Hepatocellular carcinoma
    111161420
   05226 Gastric cancer
    111161420
   05220 Chronic myeloid leukemia
    111161420
   05211 Renal cell carcinoma
    111161420
  09163 Immune disease
   05323 Rheumatoid arthritis
    111161420
   05321 Inflammatory bowel disease
    111161420
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111161420
   05414 Dilated cardiomyopathy
    111161420
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111161420
   04933 AGE-RAGE signaling pathway in diabetic complications
    111161420
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111161420
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111161420
   05161 Hepatitis B
    111161420
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111161420
   05144 Malaria
    111161420
   05145 Toxoplasmosis
    111161420
   05140 Leishmaniasis
    111161420
   05142 Chagas disease
    111161420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:elk03110]
    111161420
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111161420
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111161420
Chaperones and folding catalysts [BR:elk03110]
 Intramolecular chaperones
  Others
   111161420
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111161420
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111161420
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 111161420
NCBI-ProteinID: XP_022380754
UniProt: A0A2Y9LAY3
LinkDB
Position
Unknown
AA seq 391 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETTNRI
YDKIKKSPHSIYMLFNTSELREAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNDSWR
YLSNRLLAPSDTPEWLSFDVTGVVRQWLSHGEEVEGFRLSAHCSCDSKDNTLQVDINAGL
SSSRRGDLATIHGMNRPFLLLMATPLERAQHLHTSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctgccactgctgtggctactagtg
ctgacgcctggccgaccggccgcgggactgtccacctgcaagaccatcgacatggaactg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggttccgcccggtccgctgcccgaggctgtgctggccctg
tacaacagtactcgcgaccgggtggccggggagagcgccgagccggagcccgagcctgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaccaccaacagaatc
tatgacaaaatcaagaaaagcccgcacagcatatatatgctcttcaacacatcggagctc
cgagaagcggtgcccgagcccgtcctgctctcccgggcagagttgcgcctgctgaggctc
aagttaaaagcggagcagcacgtggagctgtaccagaaatacagcaacgattcctggcgc
tacctcagcaacaggctgctggcgcccagcgacacgccagaatggctgtccttcgatgtc
actggagtcgtacggcagtggctgagccacggagaggaagtagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactccaagtggacatcaacgcagggctc
agttccagccgccgaggtgacctggccaccattcacggcatgaaccggcccttcctactc
ctcatggccaccccactggagagggcccagcacctgcacacctcccggcaccgcagggcc
ctggacaccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctctat
attgacttccgtaaggatctgggctggaagtggatccacgagcccaagggctaccacgcc
aacttctgcctggggccctgcccctacatttggagcctggacacgcagtacagcaaggtc
ctggccctgtacaaccagcacaatcctggtgcgtcggcggcgccgtgctgcgtgccacaa
gcgctggagcccctacccatcgtgtattacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system