KEGG   Enhydra lutris kenyoni (northern sea otter): 111148602
Entry
111148602         CDS       T05871                                 

Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04024  cAMP signaling pathway
elk04210  Apoptosis
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04668  TNF signaling pathway
elk04713  Circadian entrainment
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04921  Oxytocin signaling pathway
elk04926  Relaxin signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04932  Non-alcoholic fatty liver disease
elk04935  Growth hormone synthesis, secretion and action
elk05031  Amphetamine addiction
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05161  Hepatitis B
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05224  Breast cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05323  Rheumatoid arthritis
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111148602
   04668 TNF signaling pathway
    111148602
   04024 cAMP signaling pathway
    111148602
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111148602
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111148602
   04660 T cell receptor signaling pathway
    111148602
   04658 Th1 and Th2 cell differentiation
    111148602
   04659 Th17 cell differentiation
    111148602
   04657 IL-17 signaling pathway
    111148602
   04662 B cell receptor signaling pathway
    111148602
  09152 Endocrine system
   04915 Estrogen signaling pathway
    111148602
   04917 Prolactin signaling pathway
    111148602
   04921 Oxytocin signaling pathway
    111148602
   04926 Relaxin signaling pathway
    111148602
   04935 Growth hormone synthesis, secretion and action
    111148602
   04928 Parathyroid hormone synthesis, secretion and action
    111148602
  09156 Nervous system
   04725 Cholinergic synapse
    111148602
   04728 Dopaminergic synapse
    111148602
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111148602
  09159 Environmental adaptation
   04713 Circadian entrainment
    111148602
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148602
   05231 Choline metabolism in cancer
    111148602
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111148602
  09162 Cancer: specific types
   05210 Colorectal cancer
    111148602
   05224 Breast cancer
    111148602
  09163 Immune disease
   05323 Rheumatoid arthritis
    111148602
  09165 Substance dependence
   05031 Amphetamine addiction
    111148602
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111148602
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111148602
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111148602
   05135 Yersinia infection
    111148602
   05133 Pertussis
    111148602
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111148602
   05170 Human immunodeficiency virus 1 infection
    111148602
   05161 Hepatitis B
    111148602
   05171 Coronavirus disease - COVID-19
    111148602
   05162 Measles
    111148602
   05167 Kaposi sarcoma-associated herpesvirus infection
    111148602
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111148602
   05142 Chagas disease
    111148602
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111148602
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111148602
   04131 Membrane trafficking [BR:elk04131]
    111148602
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    111148602
Membrane trafficking [BR:elk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    111148602
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 111148602
NCBI-ProteinID: XP_022361015
UniProt: A0A2Y9JT90
LinkDB
Position
Unknown
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPVKSISSVELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGLGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgattacgaggcgtcctcctcccgctgcagcagcgcc
tccccggccggggacaacctctcctactaccactcaccggccgactccttctccagcatg
ggctcgccagtcaatgcgcaggacttctgcacggatctggccgtctccagtgccaacttt
atcccgacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc
ctggtctcctccgtggccccatcacagaccagagccccccatccttatggagtcccgacc
ccctctgctggggcttactccagggctggagtcgtgaagaccatgaccggaggcagagct
cagagcattggccggaggggcaaagtggaacagttgtccccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggccgcagccaagtgccggaaccgaaggagggag
ctgacggacacactccaagcggaaacagaccaactggaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggagaagctagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttccccgaagagatgtctgtggcttcc
ctcgatctgagcgggggcctgcccgaagctgccacccccgagtcggaggaggccttcacc
ctgcccctcctcaatgatcccgagcccaagccctccgttgagccagtcaagagcatcagc
agtgtggagctcaaggccgagccctttgatgacttcctgttcccagcatcgtccaggccc
agtggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca
gcagactgggagcccctgcacggtggctccctggggttggggcccatggccacagagctg
gagcccctgtgcacccccgtggtcacctgtactcccagctgcactacctacacgtcttcc
tttgtcttcacctacccggaggctgactccttccccagctgtgcggctgctcaccgcaag
ggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacactgctggccctg
tga

DBGET integrated database retrieval system