KEGG   Enhydra lutris kenyoni (northern sea otter): 111148765
Entry
111148765         CDS       T05871                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04261  Adrenergic signaling in cardiomyocytes
elk04370  VEGF signaling pathway
elk04371  Apelin signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04910  Insulin signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04920  Adipocytokine signaling pathway
elk04922  Glucagon signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04926  Relaxin signaling pathway
elk04929  GnRH secretion
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05017  Spinocerebellar ataxia
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111148765
   04012 ErbB signaling pathway
    111148765
   04014 Ras signaling pathway
    111148765
   04015 Rap1 signaling pathway
    111148765
   04370 VEGF signaling pathway
    111148765
   04371 Apelin signaling pathway
    111148765
   04630 JAK-STAT signaling pathway
    111148765
   04668 TNF signaling pathway
    111148765
   04066 HIF-1 signaling pathway
    111148765
   04068 FoxO signaling pathway
    111148765
   04072 Phospholipase D signaling pathway
    111148765
   04071 Sphingolipid signaling pathway
    111148765
   04024 cAMP signaling pathway
    111148765
   04022 cGMP-PKG signaling pathway
    111148765
   04151 PI3K-Akt signaling pathway
    111148765
   04152 AMPK signaling pathway
    111148765
   04150 mTOR signaling pathway
    111148765
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111148765
  09143 Cell growth and death
   04210 Apoptosis
    111148765
   04218 Cellular senescence
    111148765
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111148765
   04550 Signaling pathways regulating pluripotency of stem cells
    111148765
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111148765
   04613 Neutrophil extracellular trap formation
    111148765
   04620 Toll-like receptor signaling pathway
    111148765
   04625 C-type lectin receptor signaling pathway
    111148765
   04660 T cell receptor signaling pathway
    111148765
   04662 B cell receptor signaling pathway
    111148765
   04664 Fc epsilon RI signaling pathway
    111148765
   04666 Fc gamma R-mediated phagocytosis
    111148765
   04062 Chemokine signaling pathway
    111148765
  09152 Endocrine system
   04910 Insulin signaling pathway
    111148765
   04922 Glucagon signaling pathway
    111148765
   04923 Regulation of lipolysis in adipocytes
    111148765
   04920 Adipocytokine signaling pathway
    111148765
   04929 GnRH secretion
    111148765
   04915 Estrogen signaling pathway
    111148765
   04914 Progesterone-mediated oocyte maturation
    111148765
   04917 Prolactin signaling pathway
    111148765
   04926 Relaxin signaling pathway
    111148765
   04935 Growth hormone synthesis, secretion and action
    111148765
   04919 Thyroid hormone signaling pathway
    111148765
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111148765
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111148765
  09156 Nervous system
   04725 Cholinergic synapse
    111148765
   04728 Dopaminergic synapse
    111148765
   04722 Neurotrophin signaling pathway
    111148765
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111148765
  09149 Aging
   04211 Longevity regulating pathway
    111148765
   04213 Longevity regulating pathway - multiple species
    111148765
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148765
   05205 Proteoglycans in cancer
    111148765
   05230 Central carbon metabolism in cancer
    111148765
   05231 Choline metabolism in cancer
    111148765
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111148765
  09162 Cancer: specific types
   05210 Colorectal cancer
    111148765
   05212 Pancreatic cancer
    111148765
   05225 Hepatocellular carcinoma
    111148765
   05226 Gastric cancer
    111148765
   05214 Glioma
    111148765
   05221 Acute myeloid leukemia
    111148765
   05220 Chronic myeloid leukemia
    111148765
   05218 Melanoma
    111148765
   05211 Renal cell carcinoma
    111148765
   05215 Prostate cancer
    111148765
   05213 Endometrial cancer
    111148765
   05224 Breast cancer
    111148765
   05222 Small cell lung cancer
    111148765
   05223 Non-small cell lung cancer
    111148765
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111148765
   05017 Spinocerebellar ataxia
    111148765
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111148765
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111148765
   04931 Insulin resistance
    111148765
   04933 AGE-RAGE signaling pathway in diabetic complications
    111148765
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111148765
   05135 Yersinia infection
    111148765
   05152 Tuberculosis
    111148765
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111148765
   05170 Human immunodeficiency virus 1 infection
    111148765
   05161 Hepatitis B
    111148765
   05160 Hepatitis C
    111148765
   05164 Influenza A
    111148765
   05162 Measles
    111148765
   05168 Herpes simplex virus 1 infection
    111148765
   05163 Human cytomegalovirus infection
    111148765
   05167 Kaposi sarcoma-associated herpesvirus infection
    111148765
   05169 Epstein-Barr virus infection
    111148765
   05165 Human papillomavirus infection
    111148765
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111148765
   05142 Chagas disease
    111148765
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111148765
   01524 Platinum drug resistance
    111148765
   01522 Endocrine resistance
    111148765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111148765
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111148765
Protein kinases [BR:elk01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111148765
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 111148765
NCBI-ProteinID: XP_022361269
UniProt: A0A2Y9JNZ0
LinkDB
Position
Unknown
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALHYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFEL
ILMEELRFPRTLSPEAKSLLSGLLRKDPKQRLGGGPEDAKEIMQHRFFASVVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQGDNMEGEDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggttggctgcacaagagaggggagtacatcaaa
acctggcgaccgaggtacttcctgctcaagaacgatggcacctttatcggctacaaggag
cggccccaggatgtggagcagcgagagtcccctctcaacaacttctctgtggctcaatgc
cagctgatgaagacggagcggccccgacccaacaccttcatcatccgctgtctgcagtgg
accacggtgatcgagcggaccttccacgtggagacccctgaggagcgggaggagtggacg
accgccatccagacggtggccgacgggcttaagaggcaggaggaggagatgatggacttc
aggtcgggctcgcccagcgacaactcgggggccgaggagatggaggtgtccctggccaag
cccaagcaccgtgtgaccatgaatgagtttgagtacctgaagttgctggggaagggcacg
ttcgggaaggtgatcttggtgaaggagaaggcaacgggccgctactatgccatgaaaatc
ctcaagaaggaggtcatcgtggctaaggacgaggtcgcccacacgctcacggagaaccgt
gttctccagaactcgaggcatccgttcctgacggccctgaagtactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacgggggcgagctcttcttccacctgtcc
cgggagcgcgtgttccccgaggaccgggcgcgcttctacggcgctgagatcgtgtccgcc
ctgcactacttgcactcggagaagaacgtcgtctaccgcgacctcaagttggagaacctc
atgctggacaaggacgggcacatcaagatcaccgacttcggcctgtgcaaggagggcatc
aaggacggggccaccatgaagaccttctgcgggacgcccgagtacctggcccccgaggtg
ctggaggacaatgactacggccgggcggtcgactggtgggggctgggcgtggtcatgtac
gagatgctgtgcggccgcctgccgttctacaaccaggaccacgagaagctcttcgagctc
atcctcatggaggagctccgcttcccgcgcacgctcagccccgaggccaagtccctgctg
tcggggctgctccggaaagacccgaagcagaggcttggagggggcccggaggacgccaag
gagatcatgcagcaccgtttcttcgctagtgtcgtgtggcaggacgtgtatgagaagaag
ctcagtccacccttcaagccacaggtcacgtcagagacggacaccagatacttcgacgag
gagttcacggcgcagatgatcaccatcacgccgcccgaccagggtgacaacatggagggt
gaggacagtgagcggaggccccacttcccacagttctcctactcggccagcggcacggcc
tga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111150885
Entry
111150885         CDS       T05871                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04261  Adrenergic signaling in cardiomyocytes
elk04370  VEGF signaling pathway
elk04371  Apelin signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04910  Insulin signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04920  Adipocytokine signaling pathway
elk04922  Glucagon signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04926  Relaxin signaling pathway
elk04929  GnRH secretion
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05017  Spinocerebellar ataxia
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111150885
   04012 ErbB signaling pathway
    111150885
   04014 Ras signaling pathway
    111150885
   04015 Rap1 signaling pathway
    111150885
   04370 VEGF signaling pathway
    111150885
   04371 Apelin signaling pathway
    111150885
   04630 JAK-STAT signaling pathway
    111150885
   04668 TNF signaling pathway
    111150885
   04066 HIF-1 signaling pathway
    111150885
   04068 FoxO signaling pathway
    111150885
   04072 Phospholipase D signaling pathway
    111150885
   04071 Sphingolipid signaling pathway
    111150885
   04024 cAMP signaling pathway
    111150885
   04022 cGMP-PKG signaling pathway
    111150885
   04151 PI3K-Akt signaling pathway
    111150885
   04152 AMPK signaling pathway
    111150885
   04150 mTOR signaling pathway
    111150885
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111150885
  09143 Cell growth and death
   04210 Apoptosis
    111150885
   04218 Cellular senescence
    111150885
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111150885
   04550 Signaling pathways regulating pluripotency of stem cells
    111150885
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111150885
   04613 Neutrophil extracellular trap formation
    111150885
   04620 Toll-like receptor signaling pathway
    111150885
   04625 C-type lectin receptor signaling pathway
    111150885
   04660 T cell receptor signaling pathway
    111150885
   04662 B cell receptor signaling pathway
    111150885
   04664 Fc epsilon RI signaling pathway
    111150885
   04666 Fc gamma R-mediated phagocytosis
    111150885
   04062 Chemokine signaling pathway
    111150885
  09152 Endocrine system
   04910 Insulin signaling pathway
    111150885
   04922 Glucagon signaling pathway
    111150885
   04923 Regulation of lipolysis in adipocytes
    111150885
   04920 Adipocytokine signaling pathway
    111150885
   04929 GnRH secretion
    111150885
   04915 Estrogen signaling pathway
    111150885
   04914 Progesterone-mediated oocyte maturation
    111150885
   04917 Prolactin signaling pathway
    111150885
   04926 Relaxin signaling pathway
    111150885
   04935 Growth hormone synthesis, secretion and action
    111150885
   04919 Thyroid hormone signaling pathway
    111150885
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111150885
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111150885
  09156 Nervous system
   04725 Cholinergic synapse
    111150885
   04728 Dopaminergic synapse
    111150885
   04722 Neurotrophin signaling pathway
    111150885
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111150885
  09149 Aging
   04211 Longevity regulating pathway
    111150885
   04213 Longevity regulating pathway - multiple species
    111150885
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111150885
   05205 Proteoglycans in cancer
    111150885
   05230 Central carbon metabolism in cancer
    111150885
   05231 Choline metabolism in cancer
    111150885
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111150885
  09162 Cancer: specific types
   05210 Colorectal cancer
    111150885
   05212 Pancreatic cancer
    111150885
   05225 Hepatocellular carcinoma
    111150885
   05226 Gastric cancer
    111150885
   05214 Glioma
    111150885
   05221 Acute myeloid leukemia
    111150885
   05220 Chronic myeloid leukemia
    111150885
   05218 Melanoma
    111150885
   05211 Renal cell carcinoma
    111150885
   05215 Prostate cancer
    111150885
   05213 Endometrial cancer
    111150885
   05224 Breast cancer
    111150885
   05222 Small cell lung cancer
    111150885
   05223 Non-small cell lung cancer
    111150885
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111150885
   05017 Spinocerebellar ataxia
    111150885
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111150885
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111150885
   04931 Insulin resistance
    111150885
   04933 AGE-RAGE signaling pathway in diabetic complications
    111150885
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111150885
   05135 Yersinia infection
    111150885
   05152 Tuberculosis
    111150885
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111150885
   05170 Human immunodeficiency virus 1 infection
    111150885
   05161 Hepatitis B
    111150885
   05160 Hepatitis C
    111150885
   05164 Influenza A
    111150885
   05162 Measles
    111150885
   05168 Herpes simplex virus 1 infection
    111150885
   05163 Human cytomegalovirus infection
    111150885
   05167 Kaposi sarcoma-associated herpesvirus infection
    111150885
   05169 Epstein-Barr virus infection
    111150885
   05165 Human papillomavirus infection
    111150885
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111150885
   05142 Chagas disease
    111150885
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111150885
   01524 Platinum drug resistance
    111150885
   01522 Endocrine resistance
    111150885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111150885
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111150885
Protein kinases [BR:elk01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111150885
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 111150885
NCBI-ProteinID: XP_022364272
UniProt: A0A2Y9JT87
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccgttgtgaaagaaggctgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttctcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtcttcagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagagtggacagaa
gccattcaagctgtagcagacagacttcagagacaagaagaggaaagaatgaattgtagt
ccaacttcacaaattgataatataggggaggaagagatggatgcttccacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggcaaatactatgctatgaagattctgaag
aaagaagttattatcgcaaaggacgaagtggcacatactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgtaaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaaggaatcacagatgca
gccaccatgaagacattctgtggcacaccagagtatctggcaccagaggtgttagaagac
aacgactatggccgagctgtggattggtggggcctgggggttgtcatgtatgagatgatg
tgtgggaggctacctttctacaaccaggatcatgagaaactttttgaactaatactaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcactgctttcagggctc
ttgataaaggatccaaataaacgccttggcgggggcccagatgatgcaaaagaaattatg
aggcacagtttcttctctggagtcaactggcaagatgtatacgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgacgaggacggcatggactgcgtc
gacaacgagcggcggccacacttccctcagttctcctattctgccagcggccgcgagtaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161374
Entry
111161374         CDS       T05871                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04261  Adrenergic signaling in cardiomyocytes
elk04370  VEGF signaling pathway
elk04371  Apelin signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04910  Insulin signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04920  Adipocytokine signaling pathway
elk04922  Glucagon signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04926  Relaxin signaling pathway
elk04929  GnRH secretion
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05017  Spinocerebellar ataxia
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111161374
   04012 ErbB signaling pathway
    111161374
   04014 Ras signaling pathway
    111161374
   04015 Rap1 signaling pathway
    111161374
   04370 VEGF signaling pathway
    111161374
   04371 Apelin signaling pathway
    111161374
   04630 JAK-STAT signaling pathway
    111161374
   04668 TNF signaling pathway
    111161374
   04066 HIF-1 signaling pathway
    111161374
   04068 FoxO signaling pathway
    111161374
   04072 Phospholipase D signaling pathway
    111161374
   04071 Sphingolipid signaling pathway
    111161374
   04024 cAMP signaling pathway
    111161374
   04022 cGMP-PKG signaling pathway
    111161374
   04151 PI3K-Akt signaling pathway
    111161374
   04152 AMPK signaling pathway
    111161374
   04150 mTOR signaling pathway
    111161374
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111161374
  09143 Cell growth and death
   04210 Apoptosis
    111161374
   04218 Cellular senescence
    111161374
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111161374
   04550 Signaling pathways regulating pluripotency of stem cells
    111161374
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111161374
   04613 Neutrophil extracellular trap formation
    111161374
   04620 Toll-like receptor signaling pathway
    111161374
   04625 C-type lectin receptor signaling pathway
    111161374
   04660 T cell receptor signaling pathway
    111161374
   04662 B cell receptor signaling pathway
    111161374
   04664 Fc epsilon RI signaling pathway
    111161374
   04666 Fc gamma R-mediated phagocytosis
    111161374
   04062 Chemokine signaling pathway
    111161374
  09152 Endocrine system
   04910 Insulin signaling pathway
    111161374
   04922 Glucagon signaling pathway
    111161374
   04923 Regulation of lipolysis in adipocytes
    111161374
   04920 Adipocytokine signaling pathway
    111161374
   04929 GnRH secretion
    111161374
   04915 Estrogen signaling pathway
    111161374
   04914 Progesterone-mediated oocyte maturation
    111161374
   04917 Prolactin signaling pathway
    111161374
   04926 Relaxin signaling pathway
    111161374
   04935 Growth hormone synthesis, secretion and action
    111161374
   04919 Thyroid hormone signaling pathway
    111161374
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111161374
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111161374
  09156 Nervous system
   04725 Cholinergic synapse
    111161374
   04728 Dopaminergic synapse
    111161374
   04722 Neurotrophin signaling pathway
    111161374
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111161374
  09149 Aging
   04211 Longevity regulating pathway
    111161374
   04213 Longevity regulating pathway - multiple species
    111161374
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161374
   05205 Proteoglycans in cancer
    111161374
   05230 Central carbon metabolism in cancer
    111161374
   05231 Choline metabolism in cancer
    111161374
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111161374
  09162 Cancer: specific types
   05210 Colorectal cancer
    111161374
   05212 Pancreatic cancer
    111161374
   05225 Hepatocellular carcinoma
    111161374
   05226 Gastric cancer
    111161374
   05214 Glioma
    111161374
   05221 Acute myeloid leukemia
    111161374
   05220 Chronic myeloid leukemia
    111161374
   05218 Melanoma
    111161374
   05211 Renal cell carcinoma
    111161374
   05215 Prostate cancer
    111161374
   05213 Endometrial cancer
    111161374
   05224 Breast cancer
    111161374
   05222 Small cell lung cancer
    111161374
   05223 Non-small cell lung cancer
    111161374
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111161374
   05017 Spinocerebellar ataxia
    111161374
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111161374
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111161374
   04931 Insulin resistance
    111161374
   04933 AGE-RAGE signaling pathway in diabetic complications
    111161374
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111161374
   05135 Yersinia infection
    111161374
   05152 Tuberculosis
    111161374
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111161374
   05170 Human immunodeficiency virus 1 infection
    111161374
   05161 Hepatitis B
    111161374
   05160 Hepatitis C
    111161374
   05164 Influenza A
    111161374
   05162 Measles
    111161374
   05168 Herpes simplex virus 1 infection
    111161374
   05163 Human cytomegalovirus infection
    111161374
   05167 Kaposi sarcoma-associated herpesvirus infection
    111161374
   05169 Epstein-Barr virus infection
    111161374
   05165 Human papillomavirus infection
    111161374
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111161374
   05142 Chagas disease
    111161374
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111161374
   01524 Platinum drug resistance
    111161374
   01522 Endocrine resistance
    111161374
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111161374
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111161374
Protein kinases [BR:elk01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111161374
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 111161374
NCBI-ProteinID: XP_022380696
UniProt: A0A2Y9L475
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDPSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAREVMEHRFFVSVSWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccccggtacttcctgttgaagagtgacggctccttcatcggctacaaggag
cggcctgatgcccctgaccagaccctgccccccctgaacaacttctctgtcgcagaatgc
cagctgatgaagactgagagaccacggcccaatacctttgtcatacgctgcctgcagtgg
accacggtcatcgagaggaccttccatgtagactctccagatgagagggaagagtggatg
cgagccattcagatggttgccaacagcctcaagcagcggggcccaggtgaggaccccatg
gactataagtgtggctcccccagcgacccttctgcggctgaggagatggaagtggcagtt
agcaaggcccgggccaaagtgaccatgaatgacttcgactatctcaaacttctgggcaag
ggcacctttggcaaagtgattctggtgcgagagaaggccagtggccggtactatgccatg
aagatcctgcggaaggaagttatcatcgccaaggatgaagttgcccacacggtcaccgag
agccgggtcctacagaacaccagacacccgttcctcaccgccctgaagtacgccttccag
acccatgaccgcctgtgtttcgtgatggagtacgccaatggcggcgagctgtttttccac
ctgtcccgggagcgcgtcttcacggaggagcgggctcgcttctatggcgcagagatcgtc
tctgcccttgagtatctgcactcgagggacgtggtgtaccgtgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcacggacttcggcctatgcaaagaaggc
atcagtgacggggccaccatgaaaaccttctgtgggacgcccgagtacctggcacctgag
gtgctggaggacaacgactacggccgcgcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccttg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagcgacgcc
agggaggtcatggagcacaggttcttcgtcagcgtcagctggcaggacgtggtgcagaag
aagcttctaccacccttcaaacctcaggtcacctctgaggtcgacacgaggtactttgac
gatgagtttaccgcccagtccatcacaatcacgcccccggaccgctatgacagcctgggc
tctctcgaactggaccagcggacccactttccccagttctcctactcggccagcatccgc
gagtga

DBGET integrated database retrieval system