KEGG   Enhydra lutris kenyoni (northern sea otter): 111148781
Entry
111148781         CDS       T05871                                 

Definition
(RefSeq) apoptosis regulatory protein Siva isoform X1
  KO
K22744  apoptosis regulatory protein Siva
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111148781
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 111148781
NCBI-ProteinID: XP_022361298
UniProt: A0A2Y9JJQ9
LinkDB
Position
Unknown
AA seq 175 aa
MPKRGCPFADAVPLQLKVRVGQRELSRGVCAEQHSREIFEKTKQLLFRGAQAYMDHVWEE
SCAIVDLPESPKPGPTEALRAARGQMLIGPDGRLTRSQAQAAEADLSGAATRACSSCVRA
LDGTAVCGQCERALCGRCVRACCRCGAVACSLCALVDCGDVHETLLCASCAMFEA
NT seq 528 nt   +upstreamnt  +downstreamnt
atgcccaagcggggctgtccgttcgcggacgcggtcccgctgcagctgaaggtccgggtt
ggccagagggagctgagccgcggcgtatgcgccgagcagcactcgcgggagatcttcgag
aaaaccaagcagctcctgttccgcggggctcaggcctacatggaccacgtgtgggaggag
agctgtgccatcgttgacctgccggagtccccgaagccgggccccacagaggccctccgg
gctgcacgggggcagatgctgattggaccagacggccggctgaccaggagccaagcccag
gccgctgaagctgacctgtccggggccgcgactagagcctgttcctcctgtgtgcgcgcg
ctggacgggacggcggtgtgcggccagtgtgagcgcgccctctgcgggcgctgtgtgcgt
gcctgctgccgctgcggggccgtggcctgcagcctgtgcgcccttgtggactgcggggac
gttcacgagacgctgctgtgtgccagctgcgccatgttcgaggcctga

DBGET integrated database retrieval system