KEGG   Enhydra lutris kenyoni (northern sea otter): 111148924
Entry
111148924         CDS       T05871                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04072  Phospholipase D signaling pathway
elk04144  Endocytosis
elk04151  PI3K-Akt signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04630  JAK-STAT signaling pathway
elk04810  Regulation of actin cytoskeleton
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111148924
   04014 Ras signaling pathway
    111148924
   04015 Rap1 signaling pathway
    111148924
   04630 JAK-STAT signaling pathway
    111148924
   04020 Calcium signaling pathway
    111148924
   04072 Phospholipase D signaling pathway
    111148924
   04151 PI3K-Akt signaling pathway
    111148924
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111148924
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111148924
   04540 Gap junction
    111148924
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111148924
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148924
   05206 MicroRNAs in cancer
    111148924
   05230 Central carbon metabolism in cancer
    111148924
   05231 Choline metabolism in cancer
    111148924
  09162 Cancer: specific types
   05214 Glioma
    111148924
   05218 Melanoma
    111148924
   05215 Prostate cancer
    111148924
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111148924
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111148924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111148924
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:elk04090]
    111148924
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111148924
Protein kinases [BR:elk01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111148924
CD molecules [BR:elk04090]
 Proteins
  111148924
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 111148924
NCBI-ProteinID: XP_022361426
UniProt: A0A2Y9JLH6
LinkDB
Position
Unknown
AA seq 1090 aa
MMGTSLPALLILGCLLPGPSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQY
PMSEEENPNVEIRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTEEMELEGRHIYI
YVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLISSEGVVHASYDSRQGFN
GTFSVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFN
NEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLRVPEATVKDSGDYECAARQATKEV
KEMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIEN
LTEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILD
LVDDHHGTTGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWAILASNISNIITEVHPR
DRSTVEGRVTFTRVEETIAVRCLAKNLLGAESRELKLVAPTLRSELTVAAAVLVLLVIVI
VSLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRIL
GSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVN
LLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRS
YVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSVLDSEVK
NLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGL
ARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
MVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYK
KSYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGSVDEQRLSADSGYI
IPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGID
SSDLVEDSFL
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgatggggacctcccttccggccctgctgatcttaggctgtcttctcccagggcccagc
ctaatcctctgccagctttcattaccctctatccttccaaacgaaaatgaaaaggtcgtg
cagctgaattcgtccttttctctgagatgctttggggagagtgaagtgagctggcagtac
cccatgtctgaagaagagaaccccaatgtggaaatcagaaatgaggagaacaacagcggc
ctctttgtgactgtgctggaagtggtcaatgcatccgcggcgcacacaggcttgtacact
tgctattacaaccacacacagacggaggaaatggagctcgaaggcagacacatctacatc
tatgtgccagacccagatgtagcctttgtacctttgggaatgaccgattatttagtcatc
gtggaggatgatgattctgccatcataccttgtcgcacgactgatcccgagactccggtc
accttgataagcagtgaaggggtggtgcacgcctcctatgacagcagacagggcttcaat
gggaccttcagcgtcgggccctatatctgcgaagccaccgtcagggggaagaagttccag
accattccatttaatgtttatgctttaaaagcaacatcagaacttgatctagaaatggaa
gctcttaaaactgtgtataagtcaggggagacgattgtggtcacctgtgctgtctttaac
aacgaggtggtcgaccttcagtggacgtaccccggagaagtgaaaggcaaaggcatcacc
atgctggaggaaatcaaggtcccgtccatcaaattggtgtacactctgagggtccccgag
gccacggtgaaagatagtggagattacgaatgtgctgcccgccaggccaccaaggaggtc
aaagagatgaagaaagtcaccatttctgtccatgagaaagggttcattgaaatcaaaccc
aacttcagcccactggaagctgttgacctacatgaagtcaaacatttcgtggtggacgtg
caggcctacccccctcccaggatatcctggctgaaggacaatctgactctgattgaaaat
ctcacagagatcaccacggacatagaaaagattcaggaaataagatatcggagcaaatta
aagctgatccgcgctaaggaggaagacagtggccattacacaattgttgttcaaaacgag
gatgacgtgaagagctatactttcgaactcttaactcaagttccctcctccattctggac
ttggtcgacgaccaccatggcactacggggggacagaccgtgagatgcactgctgaaggg
acgccacttcctgacatcgagtggatggtctgcaaggatattaagaagtgtaataatgaa
acttcatgggcgattttggccagcaatatctcaaacatcatcacggaggtccacccccga
gacaggagtactgtggagggacgagtgacattcaccagagtggaggaaaccatcgctgtc
cgatgtctggccaagaacctccttggggctgagagccgagagctgaagctggtggcgccc
acactgcgatccgagctcactgtggccgctgcggtcctcgtgctgctggtgattgtgatc
gtctcactcattgtcctggttgtcatttggaaacagaaacccaggtatgaaatccgttgg
agggtcattgaatccatcagccctgacggacatgaatatatttatgtggacccaatgcag
ctgccttacgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctg
ggatctggtgcgtttgggaaagtggttgaaggaaccgcctatgggttaagccgctcccag
cctgtcatgaaagtagccgtgaagatgctgaaacccacagccagatccagtgagaagcaa
gctctcatgtcggaactgaagataatgactcacctggggccacatttaaacattgtgaac
ttgctgggagcctgtaccaagtcaggccctatttacatcatcaccgaatactgcttctat
ggggatttggtcaactatttgcataagaacagggatagcttcctgagccgccacccggag
aagccgaagaaggagttggacattttcggattgaaccctgcggatgacagcacacggagt
tacgttattttatcttttgaaaacaacggggactacatggacatgaagcaggctgacacc
acacagtacgtccccatgctggagaggaaggaggtttctaagtactcagacatccagaga
tcactgtatgatcgcccagcctcatacaagaagaaatctgtgttagactcagaagtcaaa
aatctcctttcggacgacaactcagaaggccttactttgttggatttgttgagctttacc
tatcaagttgcgcgaggaatggaatttttggcttcaaaaaattgtgtccaccgggacctg
gctgctcgaaatgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggtctg
gccagagacatcatgcatgattccaactacgtgtctaaaggcagcaccttcctccccgtg
aagtggatggcccccgagagcatcttcgacaatctctacaccacgctgagtgacgtctgg
tcttacggcattctgctctgggagatcttttcccttggcggcacaccgtaccccggcatg
atggtggattcgactttctacaataagataaagagcgggtaccggatggccaagccggac
cacgccaccagtgaagtctacgagatcatggtgaagtgctggcacagtgagccagagaag
agaccctccttctaccacctgagtgagattgtggagaatctgctgcctggacagtacaag
aagagttacgagaagattcacctggactttctgaagagcgaccaccccgccgtggcgcgc
atgcgcgtggacgcagacaacgcctacatcggcgtcacctacaaaaacgaggaggacaag
ctgaaggactgggagggcagcgtggatgagcagaggctgagtgcggacagcggctacatc
atccccctgcccgacattgaccccgtccctgaggaggaagacctgggcaagaggaacaga
cacagctcgcagacctctgaagagagcgctatcgagacaggttccagcagctctaccttc
atcaagagagaggacgaaaccatcgaggacatcgacatgatggacgacattggcatagac
tcctcagacctggtagaggacagcttcctgtga

DBGET integrated database retrieval system