KEGG   Enhydra lutris kenyoni (northern sea otter): 111148970
Entry
111148970         CDS       T05871                                 

Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1 isoform X1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
elk04120  Ubiquitin mediated proteolysis
elk05162  Measles
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111148970
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111148970
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    111148970
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111148970
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111148970
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    111148970
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX zf-C3HC4_3 Prok-RING_4 zf-RING_11 zf-rbx1
Other DBs
NCBI-GeneID: 111148970
NCBI-ProteinID: XP_022361530
UniProt: A0A2Y9JUZ5
LinkDB
Position
Unknown
AA seq 261 aa
MAASAREDGARGPKQGRRGCEHYDRGCLLKAPCCDRLYTCRLCHDSNEDHQLDRFKVKEV
QCINCEKIQHAQQTCEECSTLFGEYYCSICHLFDKDKKQYHCENCGICRIGPKEDFFHCV
KCNLCLAMNLQGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG
YRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKC
NICESYNTAQAGGCRISLDQQ
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcggcctcggcgcgggaagatggcgcccgcggcccaaagcaagggcgacggggctgc
gagcactatgacagaggatgtctcctgaaggcaccttgctgtgacagactttatacttgt
cggttgtgtcatgatagcaatgaagatcatcagctagatcgctttaaagtaaaggaagtg
cagtgcataaactgtgaaaaaattcagcacgcccaacagacttgcgaagaatgtagcaca
ttgtttggggaatattattgcagtatatgccatctctttgacaaagacaagaaacagtat
cattgtgaaaactgtggaatttgtaggattggtccaaaggaagactttttccactgtgtg
aaatgtaacttatgcctagctatgaatctccaaggaaagcacaagtgtattgaaaatgtt
tccaggcagaattgtccaatatgtttggaggacattcacacatcccgtgttgttgctcat
gtcttgccatgtggacatcttttacatagaacgtgttatgaagaaatgttgaaagaaggc
tacagatgtccattatgtatgcactctgctttagatatgactcggtactggagacagctg
gatgatgaggtggcacagactcccatgccgtcagaataccagaacatgactgtggatatt
ctctgcaatgattgcaatgggagatctacagtccagttccatatattaggcatgaaatgt
aatatttgtgaatcctacaatactgctcaagcgggaggatgtagaatttcactagatcag
caatga

DBGET integrated database retrieval system