KEGG   Enhydra lutris kenyoni (northern sea otter): 111149115
Entry
111149115         CDS       T05871                                 

Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04062  Chemokine signaling pathway
elk04064  NF-kappa B signaling pathway
elk04072  Phospholipase D signaling pathway
elk04218  Cellular senescence
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05132  Salmonella infection
elk05133  Pertussis
elk05134  Legionellosis
elk05135  Yersinia infection
elk05142  Chagas disease
elk05144  Malaria
elk05146  Amoebiasis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05219  Bladder cancer
elk05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111149115
   04072 Phospholipase D signaling pathway
    111149115
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111149115
   04061 Viral protein interaction with cytokine and cytokine receptor
    111149115
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111149115
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111149115
   04621 NOD-like receptor signaling pathway
    111149115
   04622 RIG-I-like receptor signaling pathway
    111149115
   04657 IL-17 signaling pathway
    111149115
   04062 Chemokine signaling pathway
    111149115
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111149115
   05202 Transcriptional misregulation in cancer
    111149115
  09162 Cancer: specific types
   05219 Bladder cancer
    111149115
  09163 Immune disease
   05323 Rheumatoid arthritis
    111149115
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111149115
   04933 AGE-RAGE signaling pathway in diabetic complications
    111149115
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111149115
   05135 Yersinia infection
    111149115
   05133 Pertussis
    111149115
   05134 Legionellosis
    111149115
  09172 Infectious disease: viral
   05161 Hepatitis B
    111149115
   05171 Coronavirus disease - COVID-19
    111149115
   05164 Influenza A
    111149115
   05163 Human cytomegalovirus infection
    111149115
   05167 Kaposi sarcoma-associated herpesvirus infection
    111149115
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111149115
   05144 Malaria
    111149115
   05142 Chagas disease
    111149115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111149115
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111149115
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Chemokines
   111149115
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Chemokines
   111149115
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 111149115
NCBI-ProteinID: XP_022361744
UniProt: A0A2Y9JQB3
LinkDB
Position
Unknown
AA seq 101 aa
MTSKLAVALLAVFLLSAVLCEAAVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPH
CENSEIIVKLVNGKEVCLDPKESWVQRIVQIFLKRAEKQES
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctctcttggcagttttcctgctttctgcagttctgtgt
gaagctgcagttctgtcaagagtgagttcagaactccgatgccagtgcattaaaacccac
tccacgccttttcatcccaaatatatcaaagaactgagagtgattgacagtggcccacat
tgtgaaaactcagaaatcattgtaaagcttgtcaatggaaaagaggtgtgcctggacccc
aaggaaagctgggtacagagaattgtgcagatatttttgaagagggctgagaaacaggaa
tcgtga

DBGET integrated database retrieval system