KEGG   Enhydra lutris kenyoni (northern sea otter): 111149458
Entry
111149458         CDS       T05871                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04340  Hedgehog signaling pathway
elk04371  Apelin signaling pathway
elk04390  Hippo signaling pathway
elk04510  Focal adhesion
elk04530  Tight junction
elk04630  JAK-STAT signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05216  Thyroid cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111149458
   04340 Hedgehog signaling pathway
    111149458
   04390 Hippo signaling pathway
    111149458
   04371 Apelin signaling pathway
    111149458
   04630 JAK-STAT signaling pathway
    111149458
   04068 FoxO signaling pathway
    111149458
   04151 PI3K-Akt signaling pathway
    111149458
   04152 AMPK signaling pathway
    111149458
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111149458
   04115 p53 signaling pathway
    111149458
   04218 Cellular senescence
    111149458
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111149458
   04530 Tight junction
    111149458
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111149458
   04921 Oxytocin signaling pathway
    111149458
   04919 Thyroid hormone signaling pathway
    111149458
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111149458
   05206 MicroRNAs in cancer
    111149458
   05205 Proteoglycans in cancer
    111149458
   05203 Viral carcinogenesis
    111149458
  09162 Cancer: specific types
   05210 Colorectal cancer
    111149458
   05212 Pancreatic cancer
    111149458
   05225 Hepatocellular carcinoma
    111149458
   05226 Gastric cancer
    111149458
   05214 Glioma
    111149458
   05216 Thyroid cancer
    111149458
   05221 Acute myeloid leukemia
    111149458
   05220 Chronic myeloid leukemia
    111149458
   05218 Melanoma
    111149458
   05219 Bladder cancer
    111149458
   05215 Prostate cancer
    111149458
   05213 Endometrial cancer
    111149458
   05224 Breast cancer
    111149458
   05222 Small cell lung cancer
    111149458
   05223 Non-small cell lung cancer
    111149458
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111149458
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111149458
   04934 Cushing syndrome
    111149458
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111149458
   05162 Measles
    111149458
   05160 Hepatitis C
    111149458
   05163 Human cytomegalovirus infection
    111149458
   05167 Kaposi sarcoma-associated herpesvirus infection
    111149458
   05169 Epstein-Barr virus infection
    111149458
   05165 Human papillomavirus infection
    111149458
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111149458
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111149458
NCBI-ProteinID: XP_022362257
UniProt: A0A2Y9JMR7
LinkDB
Position
Unknown
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENRQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGGSNSFLSCHRLTRFLSKVIKCD
ADCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccaactcttatgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcaccc
tccgtgtcctacttcaaatgtgtgcagaaggagatactgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacactgacaactccatccggcctgacgagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgcgatgaccccgcatgacttc
attgaacacttcctgtccaagatgcccgtggccgaggagaacagacagatcattcgcaag
cacgcgcagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaacccaccg
tccatggtggcagccgggagcgtggtggccgccgtgcaaggcctgcacctgggaggttcc
aatagcttcctgtcctgccatcgccttactcggttcctctccaaagtgatcaagtgtgac
gcggactgtctccgcgcgtgccaggagcagatcgaagctctgttggagtccagcctgcgc
caggcccagcagcagagcctggaccccaaggcggcggaggaagaggaggaagaggaggag
gccgatctggcctgcacacccaccgacgtgcgagatgtgaacatttga

DBGET integrated database retrieval system