KEGG   Enhydra lutris kenyoni (northern sea otter): 111149557
Entry
111149557         CDS       T05871                                 

Definition
(RefSeq) p53-induced death domain-containing protein 1 isoform X1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04064  NF-kappa B signaling pathway
elk04115  p53 signaling pathway
elk04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111149557
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111149557
   04115 p53 signaling pathway
    111149557
SSDB
Motif
Pfam: LRR_8 Peptidase_S68 LRR_4 ZU5 Death
Other DBs
NCBI-GeneID: 111149557
NCBI-ProteinID: XP_022362358
UniProt: A0A2Y9JMN8
LinkDB
Position
Unknown
AA seq 1019 aa
MAAEEEWLEPEAAAPEDAAGEVVDAVDGEPGDPHLLLGNRLNLHLYPRGCHRLLHLCAQR
APQLLEVEFLQLSGHEDPRLLEATLAQVPANLQHLRSLVLRGGQQQDVLGACSRGFLTTL
PAGLSDLARLAHLDLSFNSLETLPACVPQMRGLSTLLLSYNCLSELPDSLGAFPSLSFLS
VSHNCLRTLPPALGSLSALQRLDLSENLLDTLPPEIGDLSSLTELNLASNQLQGLPISLG
KSESCSSGSLGLTGSALQPLPGSTLVLHGGPCTHWLGPPWSLQSSLVALVCRPSLARAGS
GPEGPLPTLSCPLPPVGLRSLRFLILHSNLLTSVPSGLAHLPLLARLDLRDNQLRDVPPE
LLDAPFVRLQGNPLGKALPASHSAPETPVTREMPRLFLNSDLDSFLVTPQGCLVTLACGV
RLRFPAGATADPINIHYRLRLPEPRLVPLGPHDALLSAVLELRPHGVAFQQARPGHSGRG
AEQAGPGMGPSAHTSPAWQEVGLWLLFVPPRARRCREVVVRTLSDDSWSDLETHLEEEAP
KRLWAHCQVPHFSWFLVVSRPVSNTCLVPPEGTLLCSSGHPGVKVTFPPGATDEPRRVRM
QVVHMAGRELRALLEEPGAAASPLLCLSQRGTSSFLQPVTVQLPLPPGVTGLSLDRTCLH
LLYWAPPAAAWDDITAQVVLEITHLYARFRVTHFSWYWLWHTTKSCVQGLARKAWERLRL
HQVNLIALQRRRDPEQVLLQCLPRRKVDATLQRLLDRYRGPEPSDTVEMFEGEKFFAAFE
KGIDVDADRPDCVEGRIYFVFYSHLKNLKEVYVTTALDRRAQAVRGQVSFYRGAVSEEVP
EEAAAARQRKGADPLWMATLPIKLPRLRGSQGPGQGQGASLSLAPLNLGDAETGFLTQSN
LLNVAGRLGTDWPAVALHLGMPYRELQRIRHEFRDDLDGQIRCMLFSWAERQAGQPGAVG
LLVRALEQSDRLDIAEEVRAILELGRQKYKDSIQRASLAPRDLAPPEPSASQSPESAQA
NT seq 3060 nt   +upstreamnt  +downstreamnt
atggctgcagaggaggagtggctggagcccgaggcagctgctccagaagatgctgcggga
gaggttgtggatgctgtggatggcgagcctggggacccccatctcctgcttgggaaccgg
ttgaacctgcacctgtacccccggggctgccaccggctgttacatctgtgtgcgcagcgg
gccccgcagctgctggaagtggagttcttgcaattgagtggccacgaggaccctcggctg
ttggaggccaccctggcccaggtgccggccaacctgcagcaccttcgctccctggtcctc
agaggtggacaacagcaggacgtgctgggggcctgctcccggggcttcctcaccacactg
cccgctggcctgagtgacttggcccgcttggcccacctagatctgagcttcaatagcctg
gagacactgccggcctgtgtcccgcagatgcgtggcctgagcaccctcctgctgtcttac
aattgcctctcagagctcccggattcccttggagcctttccctccctctccttcctctct
gtgagccacaactgcctgcgaacgctgcccccagcactgggatccctgtccgccctgcag
cgccttgatctctcagagaaccttctagacaccctgcccccagagattggagacctgagc
agcctcaccgagctcaatctggcttccaaccagctgcaaggcctgccgatctcccttggt
aagtcggagtcgtgctcctctggctccctgggcctgacagggagtgcccttcagccgctg
cctggttccactcttgtcctccatgggggcccctgcacacactggcttggcccaccttgg
agccttcagtcctccttggtggcccttgtttgccgtccctccctggccagggcggggagt
ggccccgagggtcctctgcccacccttagctgccccctgcccccagtggggctgcggtcc
ttgcggttccttattttgcacagcaatctcctgacctcggtgccctctggcctggcccac
ctcccactgcttgcccgactggatctgagggacaaccagcttcgggacgtgcctcccgag
ctactggatgccccctttgtgcgccttcaggggaaccccctgggcaaggctctacctgcc
tcccacagtgccccagagacgcctgtgacccgcgaaatgcccagactgttcctgaactca
gacttggacagcttcctggtgactccccaaggctgcttggtgaccctggcctgtggggtc
cgcctgaggtttcctgctggggccaccgctgaccctatcaacatccactatcgactccgg
ctgccagagccacgccttgtccccttgggtccccatgacgccctgctcagcgctgtcctg
gagctgcggccccatggggtggccttccagcaggcacggccagggcattcggggaggggg
gcagagcaggcgggcccaggcatgggccccagtgctcacaccagcccggcctggcaggag
gtgggcctgtggctactctttgtgcccccccgggcccggcgctgccgtgaggtggtggtc
aggaccctgagtgatgacagctggagcgacttggagacgcacctggaggaagaggcaccc
aagcggctttgggctcactgccaggtgccccacttctcgtggttcctcgtggtttcacgt
cctgtatccaacacctgccttgtgccaccggaggggacattgctgtgctcctctggacat
cctggggtcaaagtcacattcccccctggtgccaccgatgagcctcgtcgcgtccgcatg
caggtggtacacatggctggcagagagcttcgagccctccttgaggagcccggggcggcg
gccagccccctgctgtgcctctcccagcgtggcacctccagcttcctccagcctgtcacc
gtgcagctgcctctgccccctggtgtcacaggcctgagtctggatcgcacttgtcttcac
ctgctgtactgggcgcctcctgcagcggcctgggatgacatcacagcccaggtggtgctg
gagatcacccacctgtatgctcgcttccgggtcacacacttctcttggtactggctctgg
cacaccaccaagagctgtgtgcagggcctggctcggaaagcctgggagcgcctgcggctg
caccaggtcaacctcatcgccctgcagcggcgccgggaccccgagcaggtcctgctccag
tgtttgccccgccgcaaggtggacgccaccctgcagcggctgctggaccggtaccgaggc
cctgagccctctgacacagtggagatgttcgagggcgaaaaattctttgctgccttcgag
aagggtattgacgtggatgctgatcgcccagactgtgtggagggcaggatctacttcgtg
ttttactcacacttgaagaacttgaaggaagtgtatgtgaccaccgccctggatcggcgg
gctcaggctgtgaggggccaggtgtccttctaccggggagcagtgtcggaggaggtgccc
gaggaggcagcggctgcccggcagaggaagggcgcagaccccctgtggatggccactctg
cccatcaagctgccgagactgcgggggtcccaggggccagggcagggccagggggctagc
ctctccctggctcctctgaacctgggtgatgctgagactggcttcctgacccagagcaac
ctgctgaacgtggctgggcgcctgggcactgactggccggctgtggccctgcacctgggc
atgccctaccgagagctgcagcgcatccgacacgagttccgggacgacctggacggtcag
atccgttgtatgctcttctcctgggctgagcgccaggcagggcagcctggggccgtgggt
ctcctagtgcgggccttggagcagagcgaccggctggatatagctgaagaggtgagggct
atcttggagctcggccgccaaaagtacaaggacagcatccagcgtgcaagcctcgccccc
agggaccttgccccacctgagccttcagcatcacagtccccagagtctgcccaggcctag

DBGET integrated database retrieval system