KEGG   Enhydra lutris kenyoni (northern sea otter): 111149724
Entry
111149724         CDS       T05871                                 

Definition
(RefSeq) fos-related antigen 1 isoform X1
  KO
K04502  fos-like antigen 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04310  Wnt signaling pathway
elk04380  Osteoclast differentiation
elk04657  IL-17 signaling pathway
elk05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111149724
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    111149724
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111149724
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111149724
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111149724
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    111149724
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Siah-Interact_N Macoilin TMCO5 DUF4407
Other DBs
NCBI-GeneID: 111149724
NCBI-ProteinID: XP_022362668
UniProt: A0A2Y9JNI7
LinkDB
Position
Unknown
AA seq 271 aa
MFRDFGEPGPSSGAGGAYGGPAQPPTSGQQKFHLVPSVNAVSGSQELQWMVQPHFLGPSS
YPRPLAYSPYNPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCR
NRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGATECDT
GGAGGTGGTSGPPAPSRPVPCISLSSGPVLEPEALHTPTLMTTPSLTPFTPSPVFTYPST
PEPCASAHRRSSSSSGDPSSDPLGSPTLLAL
NT seq 816 nt   +upstreamnt  +downstreamnt
atgttccgagacttcggggaacccggaccgagctccggggccggcggtgcgtacggcggc
cctgcgcagccccccacttcaggccagcagaagttccaccttgtgccaagcgtcaatgct
gtgagtggcagtcaggagctgcagtggatggtgcagcctcacttcctcggacccagcagc
taccccaggcctctggcctactccccgtacaaccccccacagccccggccaggagtcatc
cgggcactagggccacctccaggggtacgacgccggccctgtgaacagatcagcccggag
gaggaggagcgccgtcgagtgaggcgcgagcgcaataagctggcggcggccaagtgcagg
aaccggaggaaggaactgaccgacttcctgcaggcggagaccgataaactggaggacgag
aagtccggtctgcagcgagagattgaggagctgcagaagcagaaggagcgcctggagctg
gtgctcgaagcccaccgccctatctgcaaaatcccggaaggggccacggagtgcgacact
ggcggcgcgggcggtaccggcggcaccagcggccccccagcaccttcccgccctgtacct
tgtatctctctttcctcggggcccgtgcttgaacccgaagcattgcacacccccacgctc
atgaccacaccctccctgactcctttcacccctagtccggtcttcacctaccccagcacc
cctgagccctgcgcctcagcccatcgcaggagtagcagcagcagcggggacccatcctct
gaccctctgggctcccctaccctccttgccttatga

DBGET integrated database retrieval system