KEGG   Enhydra lutris kenyoni (northern sea otter): 111149921
Entry
111149921         CDS       T05871                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04012  ErbB signaling pathway
elk04062  Chemokine signaling pathway
elk04110  Cell cycle
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04310  Wnt signaling pathway
elk04340  Hedgehog signaling pathway
elk04360  Axon guidance
elk04390  Hippo signaling pathway
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04657  IL-17 signaling pathway
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04722  Neurotrophin signaling pathway
elk04728  Dopaminergic synapse
elk04910  Insulin signaling pathway
elk04916  Melanogenesis
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05135  Yersinia infection
elk05160  Hepatitis C
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05217  Basal cell carcinoma
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111149921
   04310 Wnt signaling pathway
    111149921
   04340 Hedgehog signaling pathway
    111149921
   04390 Hippo signaling pathway
    111149921
   04151 PI3K-Akt signaling pathway
    111149921
   04150 mTOR signaling pathway
    111149921
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111149921
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111149921
   04550 Signaling pathways regulating pluripotency of stem cells
    111149921
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111149921
   04657 IL-17 signaling pathway
    111149921
   04662 B cell receptor signaling pathway
    111149921
   04062 Chemokine signaling pathway
    111149921
  09152 Endocrine system
   04910 Insulin signaling pathway
    111149921
   04917 Prolactin signaling pathway
    111149921
   04935 Growth hormone synthesis, secretion and action
    111149921
   04919 Thyroid hormone signaling pathway
    111149921
   04916 Melanogenesis
    111149921
  09156 Nervous system
   04728 Dopaminergic synapse
    111149921
   04722 Neurotrophin signaling pathway
    111149921
  09158 Development and regeneration
   04360 Axon guidance
    111149921
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111149921
  09162 Cancer: specific types
   05210 Colorectal cancer
    111149921
   05225 Hepatocellular carcinoma
    111149921
   05226 Gastric cancer
    111149921
   05217 Basal cell carcinoma
    111149921
   05215 Prostate cancer
    111149921
   05213 Endometrial cancer
    111149921
   05224 Breast cancer
    111149921
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111149921
   05020 Prion disease
    111149921
   05022 Pathways of neurodegeneration - multiple diseases
    111149921
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111149921
   04931 Insulin resistance
    111149921
   04934 Cushing syndrome
    111149921
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111149921
  09172 Infectious disease: viral
   05160 Hepatitis C
    111149921
   05162 Measles
    111149921
   05163 Human cytomegalovirus infection
    111149921
   05167 Kaposi sarcoma-associated herpesvirus infection
    111149921
   05165 Human papillomavirus infection
    111149921
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111149921
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111149921
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111149921
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     111149921
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   111149921
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111149921
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 111149921
NCBI-ProteinID: XP_022362914
UniProt: A0A2Y9JTQ9
LinkDB
Position
Unknown
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattgggaatgggtcatttggagtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgtgagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaagtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatatgccatcgg
gatattaaaccacagaacctcttgttggaccctgatacagctgtcttaaaactctgtgac
tttggaagcgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagacgta
tggtctgcaggctgtgtgttggctgagctgttattaggacaaccaatatttccaggggac
agtggtgtggatcaattggtagaaataatcaaggtcctgggaacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcgcatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cggactccaccggaggcaattgcactgtgtagccgtctgctggagtatacaccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgacgaattaagggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccctacaaatgccacagcagcctcagatgctaatgccggagaccgtggacag
accaacaacgctgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system