KEGG   Enhydra lutris kenyoni (northern sea otter): 111149956
Entry
111149956         CDS       T05871                                 

Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01523  Antifolate resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04064  NF-kappa B signaling pathway
elk04066  HIF-1 signaling pathway
elk04071  Sphingolipid signaling pathway
elk04137  Mitophagy - animal
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04218  Cellular senescence
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04917  Prolactin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04926  Relaxin signaling pathway
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05030  Cocaine addiction
elk05132  Salmonella infection
elk05133  Pertussis
elk05134  Legionellosis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05203  Viral carcinogenesis
elk05212  Pancreatic cancer
elk05215  Prostate cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05321  Inflammatory bowel disease
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111149956
   04014 Ras signaling pathway
    111149956
   04064 NF-kappa B signaling pathway
    111149956
   04668 TNF signaling pathway
    111149956
   04066 HIF-1 signaling pathway
    111149956
   04071 Sphingolipid signaling pathway
    111149956
   04024 cAMP signaling pathway
    111149956
   04151 PI3K-Akt signaling pathway
    111149956
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111149956
  09143 Cell growth and death
   04210 Apoptosis
    111149956
   04218 Cellular senescence
    111149956
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111149956
   04621 NOD-like receptor signaling pathway
    111149956
   04622 RIG-I-like receptor signaling pathway
    111149956
   04623 Cytosolic DNA-sensing pathway
    111149956
   04625 C-type lectin receptor signaling pathway
    111149956
   04660 T cell receptor signaling pathway
    111149956
   04658 Th1 and Th2 cell differentiation
    111149956
   04659 Th17 cell differentiation
    111149956
   04657 IL-17 signaling pathway
    111149956
   04662 B cell receptor signaling pathway
    111149956
   04062 Chemokine signaling pathway
    111149956
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111149956
   04917 Prolactin signaling pathway
    111149956
   04926 Relaxin signaling pathway
    111149956
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111149956
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111149956
  09149 Aging
   04211 Longevity regulating pathway
    111149956
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111149956
   05202 Transcriptional misregulation in cancer
    111149956
   05203 Viral carcinogenesis
    111149956
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111149956
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111149956
   05221 Acute myeloid leukemia
    111149956
   05220 Chronic myeloid leukemia
    111149956
   05215 Prostate cancer
    111149956
   05222 Small cell lung cancer
    111149956
  09163 Immune disease
   05321 Inflammatory bowel disease
    111149956
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111149956
   05022 Pathways of neurodegeneration - multiple diseases
    111149956
  09165 Substance dependence
   05030 Cocaine addiction
    111149956
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111149956
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111149956
   04931 Insulin resistance
    111149956
   04933 AGE-RAGE signaling pathway in diabetic complications
    111149956
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111149956
   05135 Yersinia infection
    111149956
   05133 Pertussis
    111149956
   05134 Legionellosis
    111149956
   05152 Tuberculosis
    111149956
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111149956
   05170 Human immunodeficiency virus 1 infection
    111149956
   05162 Measles
    111149956
   05164 Influenza A
    111149956
   05161 Hepatitis B
    111149956
   05160 Hepatitis C
    111149956
   05168 Herpes simplex virus 1 infection
    111149956
   05163 Human cytomegalovirus infection
    111149956
   05167 Kaposi sarcoma-associated herpesvirus infection
    111149956
   05169 Epstein-Barr virus infection
    111149956
   05165 Human papillomavirus infection
    111149956
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111149956
   05145 Toxoplasmosis
    111149956
   05140 Leishmaniasis
    111149956
   05142 Chagas disease
    111149956
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111149956
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111149956
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    111149956
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 111149956
NCBI-ProteinID: XP_022362935
UniProt: A0A2Y9JZJ2
LinkDB
Position
Unknown
AA seq 542 aa
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTTSVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGQIPNQTPALAPAPAPILAPVPAPAPAPAPILAPPGLAQAVVPPAPKTAQ
AGEGTLSEALLQLQFDADEDLGALLGSSADPAVFTDLACVDNSEFQQLLNQGVSAAPHIA
EPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQI
SS
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggacgacctgtttcccctcatcttcccgtctgaacctgcccaggcctctggcccttat
gtggagatcatcgagcagcccaagcagcggggaatgcgcttccgctacaagtgcgagggc
cgctcagcgggcagtatcccaggcgagaggagcacggataccaccaagacacatcccacc
atcaagatcaatggctacactgggccggggacggttcgcatctccctggtcaccaaagac
ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat
gaggctgagctctgcccagaccgctgcatccacagtttccagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaataataatccc
ttccaagttcccatagaagaacagcgtggggactatgacctgaacgcagtgcggctctgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacctgtcctctct
catcccatttttgacaaccgcgcccccaacaccgcagagctgaagatctgcagggtgaac
cggaactccgggagctgcctcggcggggacgagatcttcctgctgtgcgacaaggtgcag
aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttca
caagctgacgtccaccgacaagtggccattgtattccggacacctccttacgcggacccc
agcctgcaggcccccgtgcgggtctccatgcagctgcggcggccttcagatcgggagctc
agtgagcccatggagttccagtacttgccagacacagatgatcgtcaccggattgaggag
aaacgcaaaaggacatacgagaccttcaagagcatcatgaaaaaaagccccttcaatgga
cccactgaccccaggcctccaccccggcgcattgcggtgccttcccgaagcacaacatcc
gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc
gaggagttctcccccatggtctttccttcggggcagattccaaaccagacccctgccttg
gcaccggcccctgccccaatcctggccccggtcccggccccggccccagccccggcccca
atcttagcccccccgggcctcgctcaggctgtggtccccccggcccccaagaccgcccag
gccggggaagggacgctgtcggaggccctgctgcagctgcagtttgacgctgacgaagac
ctgggggccctgctgggcagcagcgctgaccccgccgtgttcacagacctggcatgcgtc
gacaactcggagtttcagcagctgctgaaccaaggtgtatctgcggccccacacatagcc
gagcccatgctgatggagtaccctgaggcaataacacgcctggtgacggggtcccagagg
ccccccgacccagctcctgctcccctgggggcctctgggctccccaacggcctcctctca
ggggatgaagacttctcctccatcgcagacatggacttctcagcccttctgagtcagatc
agctcctaa

DBGET integrated database retrieval system