KEGG   Enhydra lutris kenyoni (northern sea otter): 111149975
Entry
111149975         CDS       T05871                                 

Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04140  Autophagy - animal
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04370  VEGF signaling pathway
elk04510  Focal adhesion
elk04722  Neurotrophin signaling pathway
elk04910  Insulin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05165  Human papillomavirus infection
elk05168  Herpes simplex virus 1 infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05223  Non-small cell lung cancer
elk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111149975
   04014 Ras signaling pathway
    111149975
   04370 VEGF signaling pathway
    111149975
   04024 cAMP signaling pathway
    111149975
   04022 cGMP-PKG signaling pathway
    111149975
   04151 PI3K-Akt signaling pathway
    111149975
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111149975
  09143 Cell growth and death
   04210 Apoptosis
    111149975
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111149975
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111149975
  09152 Endocrine system
   04910 Insulin signaling pathway
    111149975
   04919 Thyroid hormone signaling pathway
    111149975
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111149975
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111149975
   05203 Viral carcinogenesis
    111149975
  09162 Cancer: specific types
   05210 Colorectal cancer
    111149975
   05212 Pancreatic cancer
    111149975
   05225 Hepatocellular carcinoma
    111149975
   05221 Acute myeloid leukemia
    111149975
   05220 Chronic myeloid leukemia
    111149975
   05218 Melanoma
    111149975
   05211 Renal cell carcinoma
    111149975
   05215 Prostate cancer
    111149975
   05213 Endometrial cancer
    111149975
   05223 Non-small cell lung cancer
    111149975
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111149975
   05014 Amyotrophic lateral sclerosis
    111149975
   05020 Prion disease
    111149975
   05022 Pathways of neurodegeneration - multiple diseases
    111149975
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111149975
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111149975
   05161 Hepatitis B
    111149975
   05160 Hepatitis C
    111149975
   05162 Measles
    111149975
   05168 Herpes simplex virus 1 infection
    111149975
   05165 Human papillomavirus infection
    111149975
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111149975
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111149975
   01524 Platinum drug resistance
    111149975
   01522 Endocrine resistance
    111149975
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 111149975
NCBI-ProteinID: XP_022362968
UniProt: A0A2Y9JTW0
LinkDB
Position
Unknown
AA seq 168 aa
MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGLGKHLQTAPGLLGEAGHQQGQPASSSH
HGGAGAVETRSRHSSYPAGTEEDEEMEEEELSPFRGRSQSAPPNLCAALRYGRELRRMSD
EFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcccagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggatcaacccccaggccttggcaagcacctgcagacg
gccccaggcctcctaggggaagctggtcaccagcaggggcagccggccagcagcagccac
catggaggcgctggggctgtggagacgcggagtcgccacagctcgtaccccgcggggacc
gaggaagatgaggagatggaggaggaagagcttagccctttccgggggcgctcgcagtca
gcgccccccaacctctgtgctgcactgcgttatggccgcgagctccggaggatgagcgac
gagttccagggctccttcaagggacttcctcgcccgaagagtgcgggcacagccacgcag
atgcgacaaagccccagttggacgcgcgtcatccagtcctggtgggatcggaacttgggg
agaggaggctccgccccctcccaatga

DBGET integrated database retrieval system