KEGG   Enhydra lutris kenyoni (northern sea otter): 111150032
Entry
111150032         CDS       T05871                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04217  Necroptosis
elk04650  Natural killer cell mediated cytotoxicity
elk05132  Salmonella infection
elk05164  Influenza A
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111150032
   04061 Viral protein interaction with cytokine and cytokine receptor
    111150032
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111150032
   04217 Necroptosis
    111150032
   04115 p53 signaling pathway
    111150032
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111150032
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111150032
  09172 Infectious disease: viral
   05164 Influenza A
    111150032
Cytokine receptors [BR:elk04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111150032
CD molecules [BR:elk04090]
 Proteins
  111150032
SSDB
Motif
Pfam: TNFR_c6 Death ASFV_J13L CRPA
Other DBs
NCBI-GeneID: 111150032
NCBI-ProteinID: XP_022363057
UniProt: A0A2Y9JPX7
LinkDB
Position
Unknown
AA seq 433 aa
MGALRGAVRALPAPHPSVSCLVVLWVSVGAAVPLLGGEPDCGLDKYKPDGLEWCCKKCPA
GSHVSRHCGANHGVPLCSQCEPGTFLAYQNGQTSCQPCTTCRADQEVVAACTQTSDQQCQ
CKTGSFYCDSLNCVENCLRCRRCAGAVIRPCNATHDTVCDSDAGADTPGKQTPKDVSVHG
FKIVIVVLGIFLCIIITIVLFYVFLYCRKRKGLWPRWCFISFWRGRAGGPDSTTCPRHSE
SLVPLNSENEQPAADMEASSPGARLENEGLASTPTAAPRPAPSEEPMQGAVGGSPAMPQQ
ALQSADPMAPGAPSLRTLEQEYEAKYFVRDLSREARIYYKFERSISDKDWKPFMRFLGLE
DSDIDNCESQYPSDVMEQHHQMLRVWRNGTGKGASVFSLLAALHKMQLRMYLENIINWLL
DEGLLGRRAETSD
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgggagcgctccgcggggccgtgcgcgcgctgccggctccgcacccgtcggtgtcgtgt
ctggtcgtcctgtgggtgtctgtcggagccgcggtgcccctgctgggcggtgagcctgac
tgcggcctggacaagtacaagccggacggtctcgagtggtgttgcaagaagtgtcccgct
ggctctcacgtcagcagacactgtggtgcaaaccatggtgttccgctgtgtagccagtgt
gaacccggaaccttcctcgcctaccaaaacgggcagaccagctgccaaccgtgcactaca
tgtcgagcagaccaggaggtggtggcagcctgcacacagaccagcgaccagcagtgtcag
tgcaagacggggagcttctactgcgactcactgaactgcgtggagaattgcctccggtgt
cgcagatgtgctggtgctgtcattcggccctgcaatgccacacatgatacggtctgtgac
tcggacgctggggcagacacaccagggaaacaaacacccaaggatgtgtccgtccatggg
ttcaaaatagtcattgtcgtcctcgggatctttctctgcatcatcatcaccatcgtcctc
ttctacgtcttcctttactgccgtaagaggaaaggtttgtggcctcggtggtgcttcatc
agcttctggagaggaagggcaggcgggccggacagcactacttgccctcggcacagtgag
tctctggtgcccttgaattctgagaacgagcagccagccgctgacatggaagcgtcctcg
ccaggggccaggctggagaacgagggcttagcctcgacgcccacggccgcgccccgccca
gcgccctccgaggagccgatgcagggggcagtcggggggagccccgcgatgccacagcaa
gcgctccagagtgcagacccgatggcccctggggccccctccctcaggaccctggagcag
gaatatgaagctaagtattttgtgagggacctgtcccgtgaagcccggatctactataag
tttgaaagaagcatctctgataaagactggaaaccattcatgaggttcctcggactagag
gacagtgacatcgacaactgtgagagccagtaccccagcgacgtgatggagcagcaccac
cagatgctgcgtgtgtggaggaacggcacggggaagggcgcctctgtgttcagcctgctc
gcggcgctccataagatgcaactgcggatgtatttggaaaatatcataaactggttactc
gacgaaggactcttgggcagacgtgcggagacctctgattaa

DBGET integrated database retrieval system