KEGG   Enhydra lutris kenyoni (northern sea otter): 111150049
Entry
111150049         CDS       T05871                                 

Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05164  Influenza A
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111150049
   04621 NOD-like receptor signaling pathway
    111150049
   04622 RIG-I-like receptor signaling pathway
    111150049
   04623 Cytosolic DNA-sensing pathway
    111150049
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111150049
  09172 Infectious disease: viral
   05161 Hepatitis B
    111150049
   05160 Hepatitis C
    111150049
   05164 Influenza A
    111150049
   05162 Measles
    111150049
   05168 Herpes simplex virus 1 infection
    111150049
   05167 Kaposi sarcoma-associated herpesvirus infection
    111150049
   05169 Epstein-Barr virus infection
    111150049
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111150049
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    111150049
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 111150049
NCBI-ProteinID: XP_022363083
UniProt: A0A2Y9JPS1
LinkDB
Position
Unknown
AA seq 497 aa
MAAAADRRPPRLLFGDWLLGEVSSGRYEGLRWLDAARTRFRVPWKHFARKDLGEADSRIF
KAWAVARGRWPPRSRGGRGGGDQLALEGTLRAGWKTNFRCALHSTQRFVMLQDNSGDPAD
PHKVFALSFEPGERGAGTQQGEMALDDALPRTGGLLGPCLAGDAAERPGLGLSPELGAPS
PPFGVADSAGDLLLQALKQSCLEAHLLEAAWVGDPVPPEAPGLELRSTEPSLPRAGDTAP
VHQAQETGLAPVLEPWQPPPDVEPCPGVAAEPGSQGEPSLRALDVTIMYKGRTVLQEVVW
RPSFVFLYGSPSPATTAAEPQHVAFPSPAELPDQKQLHYTEKLLQHVAPGLQLELRGCRL
WARRLGKCKVYWEVGGPLGSASPSTPPCLLQRNQDTLIFDFSTFFREMMEFRARRRLGSP
HYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRAHLECVQREGVSSLDSGSLGLCLSSSN
SLYEDLERFLTEVQQPA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggccgcggccgctgacaggaggcccccgcgcctgctcttcggagactggcttctgggg
gaggtcagcagcggccgctacgagggcctgcggtggctggacgcggcccgcacgcgcttc
cgcgtgccctggaagcacttcgcgcggaaggacctgggagaggctgactctcgcatcttc
aaggcctgggcggtggcccgcggcaggtggccgcccaggagcaggggcggcaggggcgga
ggcgaccagctggccctggagggcacgctccgggccggctggaaaaccaactttcgctgt
gcgctgcacagcacccagcggtttgtgatgctgcaggacaactcaggggaccccgccgac
ccgcacaaagtgttcgcgctcagcttcgagcctggggagagaggtgcgggcactcagcag
ggggagatggccctggacgacgccctgccccggacgggtgggctcctaggaccatgcctg
gcaggagacgctgctgagaggccagggcttgggctgagccctgagcttggcgccccaagc
cccccttttggcgtagccgacagtgctggggacctcttgctccaggctctgaagcagagc
tgcctggaggcccacctgctggaagctgcatgggtgggggacccggtgcccccagaggct
cccggcctggagctccggagcacagagccgtccctgccaagggcaggagacacggcccct
gtgcaccaggcgcaggagacaggcctggccccggtcctggagccctggcagcctccacca
gatgtggagccttgccccggggtggctgctgagcctggatcacagggagagcccagcctg
agggccctggatgtgaccattatgtacaagggccgcacagtgctgcaggaggtggtgtgg
cgtccaagcttcgtgttcctctatggatccccaagcccagccaccacggccgctgagccc
cagcatgtggccttcccgagcccggccgagctccctgaccagaagcagctgcactacacc
gagaagctgctgcagcacgtggccccgggactgcagctggagctccggggctgtaggctg
tgggcccggcgcctgggcaaatgcaaggtctactgggaggtgggagggcccctgggctct
gccagcccctccacacccccctgcctgctgcaaaggaaccaagacaccctcatcttcgac
ttcagcaccttcttccgagagatgatggagttccgggctcgccggcgtctaggctccccg
cactacaccatctacctgggtttcgggcaggacctgtcagctgggaggcccaaggagaag
agcctggtcctggtgaagctggagccgtggctgtgccgggcgcacctggagtgcgtgcag
cgagaaggggtgtcctccctggacagcggcagccttggcctctgcctgtccagctccaac
agcctctacgaggacctggagcgcttcctcacagaggtgcagcagcccgcctga

DBGET integrated database retrieval system