KEGG   Enhydra lutris kenyoni (northern sea otter): 111150113
Entry
111150113         CDS       T05871                                 

Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03420  Nucleotide excision repair
elk04115  p53 signaling pathway
elk04120  Ubiquitin mediated proteolysis
elk05161  Hepatitis B
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111150113
  09124 Replication and repair
   03420 Nucleotide excision repair
    111150113
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111150113
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111150113
   05202 Transcriptional misregulation in cancer
    111150113
  09162 Cancer: specific types
   05210 Colorectal cancer
    111150113
   05212 Pancreatic cancer
    111150113
   05225 Hepatocellular carcinoma
    111150113
   05226 Gastric cancer
    111150113
   05214 Glioma
    111150113
   05216 Thyroid cancer
    111150113
   05220 Chronic myeloid leukemia
    111150113
   05217 Basal cell carcinoma
    111150113
   05218 Melanoma
    111150113
   05213 Endometrial cancer
    111150113
   05224 Breast cancer
    111150113
   05222 Small cell lung cancer
    111150113
   05223 Non-small cell lung cancer
    111150113
  09172 Infectious disease: viral
   05161 Hepatitis B
    111150113
   05169 Epstein-Barr virus infection
    111150113
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111150113
   03400 DNA repair and recombination proteins [BR:elk03400]
    111150113
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     111150113
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      111150113
SSDB
Motif
Pfam: WD40 EF-hand_1
Other DBs
NCBI-GeneID: 111150113
NCBI-ProteinID: XP_022363180
UniProt: A0A2Y9K087
LinkDB
Position
Unknown
AA seq 426 aa
MAPRKRPETQKTPEVAVRPKSKRSRSPWELEPEAKKLCVKGSGSSRRFDSGCLWAGLASL
QVPPPSSIVRALHHHKLGNAVWPSLQQGLQQAFLHSLASYRIFQKAAPFDRRATSLAWHP
THPSTLAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLDANQFFTSSMEGTT
RLQDFKGNTVRVFASSDTCNVWFCSLDVSARSRMVVTGDNVGHVILLNMDGRELWNLRMH
KKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKSSFLHSLPHSHPVNAACFSPDGA
QLLTTDQKSELRVYSASQWDCPPSLIPHPHRHFQHLTPIKATWHPRYNLVVVGRYPDPNF
KSCTPHELRTIDVFDGNSGKMMYQLYDPESSGIISLNEFNPMGDTLASVMGYHILIWSQE
EAGMRT
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggctcctaggaaacgcccagaaacccagaagacccccgaggtggctgtgcgccccaag
agcaagaggagcagaagcccctgggagctggagcccgaggccaagaagctctgtgtgaag
ggctctggttctagcagaagatttgactcaggctgcctttgggcggggttggctagcctg
caggtcccgccaccaagcagcatcgtcagggccctccaccaccataagctaggcaacgcc
gtctggccatcactgcagcagggtctccagcaggcctttctgcactctctggcttcttac
cggatattccaaaaggctgccccctttgacaggagggccacatccttggcatggcaccca
actcaccccagcaccctggctgtgggttccaaagggggagatatcatgctctggaacttt
ggcataaaggacaaacctaccttcattaaagggattggagctggagggagcatcactggg
ctgaagtttaaccctcttgatgccaaccagtttttcacctcctcaatggagggaacaact
aggctgcaagactttaaaggcaacactgtccgagtttttgccagctcagacacctgcaac
gtctggttttgcagcctggatgtgtctgccagaagccgaatggtggtcacgggagacaat
gtggggcacgtgatcctgctgaacatggacggcagggagctttggaatctgagaatgcac
aaaaagaaagtgacccacgtggccctgaatccatgctgtgattggttcctggccacagcc
tccgtagaccaaacagtgaaaatctgggacctgcgccaggttagagggaaatccagcttc
ctccactcactgccgcatagccatcctgtcaacgcagcctgtttcagtcctgatggagcc
cagctcctgaccactgaccagaagagtgagctccgggtttactcagcctcccagtgggac
tgccccccgagcctaatcccacaccctcaccgccacttccagcacctgacgcccatcaag
gcaacctggcatcctcggtacaacctcgttgtcgtgggccgatacccagatcctaatttc
aaaagctgtaccccccacgaattaaggacgattgatgtgtttgatggaaactcagggaag
atgatgtatcagctctatgacccagaatcttctggtatcatttcgctcaatgagttcaat
cccatgggggacacgctggcctctgtgatgggttatcacattctcatttggagccaggag
gaagctgggatgcggacatga

DBGET integrated database retrieval system