KEGG   Enhydra lutris kenyoni (northern sea otter): 111150116
Entry
111150116         CDS       T05871                                 

Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111150116
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111150116
   04090 CD molecules [BR:elk04090]
    111150116
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111150116
  Exosomal proteins of other body fluids (saliva and urine)
   111150116
  Exosomal proteins of colorectal cancer cells
   111150116
CD molecules [BR:elk04090]
 Proteins
  111150116
SSDB
Motif
Pfam: Tetraspanin DUF2157 DUF1310 CCG
Other DBs
NCBI-GeneID: 111150116
NCBI-ProteinID: XP_022363189
UniProt: A0A2Y9JUH8
LinkDB
Position
Unknown
AA seq 268 aa
MGSACIKVTKYFLFLFNLLFFILGAVILGFGVWILADKSSFISVLQTSSSSLKVGACVFI
GVGAVTMFMGFLGCIGAIKEVRCLLGLYFAFLLLILIVQVAAGALFYFNMGKLKQEMGNI
VTNLIQNYKDSHEDRLQEAWDYVQAQVKCCGWVSFYNWTENAELMNRTNITYPCSCEARR
EEEDNFVVRKGFCEAFDSNRTESRNSPEYWPVYHEGCMKKVQAWLQENVGVILGICVGVA
VIELLGMLLSICLCRHVRSEDYSKVPKY
NT seq 807 nt   +upstreamnt  +downstreamnt
atggggtcagcctgtatcaaagtcaccaaatactttctcttcctcttcaacttgctcttc
ttcatcctgggcgcggtgatcctgggtttcggggtgtggatcctggccgacaagagcagt
ttcatctctgtgctacagacctcctccagctcactcaaggtgggggcctgcgtctttatc
ggcgtgggggccgtcaccatgttcatgggcttcctgggctgcattggtgccatcaaggag
gtccgctgcctgctggggctgtactttgccttcctcctcctgatccttatcgtccaggtg
gctgcaggagccctcttctatttcaacatgggcaagctaaaacaggagatgggcaacatc
gtgaccaacctcattcagaactacaaggacagtcacgaggacagactgcaggaggcctgg
gactacgtgcaggcccaggtgaagtgctgcggctgggtcagcttctacaactggacggaa
aacgcggagctcatgaaccgcaccaacatcacctacccctgctcctgcgaggccaggagg
gaggaggaggacaacttcgtggtgaggaagggcttctgtgaggctttcgacagcaacagg
actgagagcaggaacagccccgagtactggcctgtgtaccatgagggctgcatgaagaag
gtccaggcctggctgcaggagaacgtgggcgtcatcctaggcatctgtgtgggcgtcgct
gtcatcgagctcctggggatgctcctgtccatctgcttatgccggcacgtccgctctgaa
gactacagcaaggtccccaagtactga

DBGET integrated database retrieval system