KEGG   Enhydra lutris kenyoni (northern sea otter): 111150121
Entry
111150121         CDS       T05871                                 

Definition
(RefSeq) phospholipase D1 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00564  Glycerophospholipid metabolism
elk00565  Ether lipid metabolism
elk01100  Metabolic pathways
elk04014  Ras signaling pathway
elk04024  cAMP signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04144  Endocytosis
elk04666  Fc gamma R-mediated phagocytosis
elk04724  Glutamatergic synapse
elk04912  GnRH signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk05200  Pathways in cancer
elk05212  Pancreatic cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111150121
   00565 Ether lipid metabolism
    111150121
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111150121
   04072 Phospholipase D signaling pathway
    111150121
   04071 Sphingolipid signaling pathway
    111150121
   04024 cAMP signaling pathway
    111150121
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111150121
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    111150121
  09152 Endocrine system
   04912 GnRH signaling pathway
    111150121
   04928 Parathyroid hormone synthesis, secretion and action
    111150121
  09156 Nervous system
   04724 Glutamatergic synapse
    111150121
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111150121
   05231 Choline metabolism in cancer
    111150121
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111150121
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     111150121
Membrane trafficking [BR:elk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    111150121
 Endosome - Golgi transport
  Others
   Others
    111150121
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH DUF3785 PLRV_ORF5
Other DBs
NCBI-GeneID: 111150121
NCBI-ProteinID: XP_022363199
UniProt: A0A2Y9JUI8
LinkDB
Position
Unknown
AA seq 1074 aa
MSLKNEPRVNTSTLQKIAADMSNLIENLDTRELHLEGEEVDYDVSPSDPKIQEACIPFSA
IYKTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVKEEPREMPSLPRSSENMIREEQFFGRR
KQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGLRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENTLAKWYVNAKG
YFEDVANAMEEAEEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFVMLY
KEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVVIDQSLAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTVGPSLGSFTAETTESMESLSLKDKNESSKNPPTLKS
VDDMDSKLKGIGKSRKFSKFSLYRQLYKHHMHNADSISSVDSASSYCNHCRSRQNLIHGL
KPHLKLFRSSSKSEQGLARPDVDTSSIRSLQTGMGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIGSAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELKYQVPASVHANVQLLRSAADWSAGIKYHEESIHAAYLHVIENSKHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRESQRYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAKLGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGEEYQAGRFAQGLRLQCF
RVVLGYLSEPSENIQDPVSDKFFKEVWVATAARNATIYDKVFRCLPNDEVHNLIQLRDFI
TKPVLAREDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPTEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtccctgaaaaatgagccaagagtaaatacctccacactgcagaaaatcgctgctgac
atgagtaatttgatagaaaatctggacacgcgggagctgcaccttgagggagaagaggtg
gattacgatgtttcccccagcgatcccaagatacaggaagcgtgtattccgttctctgct
atttataagactcaaggatttaaggagcctaacatacagacgtatctttccggctgtcca
ataaaagcccaagtcctggaagtggaacgctttacatctacaacaagggtgccaagtatc
aatctttacactattgaattaacacatggggaatttaagtggcaagttaagaggaaattc
aaacactttcaagaatttcacagagagctgctcaagtacaaagcttttatccgaatcccc
attcccaccagaaggcacacgtttagaagacagaacgtcaaagaagagcctcgagagatg
ccaagtttgccccgttcctctgaaaacatgatcagagaagaacagttctttggcagaagg
aaacaactagaagattatttgacaaagctactaaaaatgcccatgtatagaaactaccat
gcgacaacagaattccttgacataagccagctgtctttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatccgggggacacagaataccgggcttgaattgc
tgtggtcaaggaagagcctgctaccgctggtccaaaaggtggttgatagtgaaagattca
tttttgctatatatgaaaccggacagtggtgccattgcctttgtcctgctggtcgataaa
gaattcaaaattaaggtggggaagaaggaaacagagaccaaatatgggctccgaattgat
aatctttcaaggacacttattttaaaatgcaacagctatagacatgctcggtggtgggga
ggagctatagaagaattcatccagaaacacggcaccaactttctcaaagatcatcgattt
gggtcatacgctgctatccaagagaatactttagctaaatggtacgttaatgccaaaggg
tattttgaagatgtggcaaatgctatggaagaggcagaagaagagatttttatcacggat
tggtggttgagtccagaaatcttcctgaaacgcccggtggttgaaggaaatcgttggagg
ttggactgcattctcaaacgaaaagcacaacagggagtgagaatctttgtgatgctttac
aaagaggtggagcttgctcttgggatcaacagtgaatacagcaagaggactttgatgcgt
ctacaccccaatattaaggtgatgagacacccagatcatgtgtcatccagtgtatatctg
tgggctcatcatgagaaacttgttgttattgaccagtcattggcctttgtgggtgggatc
gacctggcctatggcagatgggatgacaatgagcataggctcacagacgtgggcagtgtg
aagcgtgtcactgtaggaccatctctgggttccttcacagctgaaacaacagagtccatg
gaatccttgagcctcaaagataaaaatgaatctagtaaaaatccacccaccctaaagagt
gttgatgatatggattcaaaactgaaaggaataggaaagtccagaaagttctctaaattt
agcctctacaggcagttgtacaagcaccacatgcacaacgcggacagcatcagcagcgtt
gacagcgcctccagttattgtaatcactgtagaagtcgtcagaatttaatccatggttta
aaaccccacctgaaactctttcgctcttccagtaagtctgagcaggggctcgctagacct
gacgtggataccagctccatccgcagtttgcagacaggcatgggagagctgcacggggaa
accaggttctggcatggaaaggactactgcaattttgtcttcaaagactgggttcaactg
gataaaccttttgctgatttcattgacagatactccacgccccggatgccttggcatgac
attggctctgcagtccatgggaaggcggctcgggacgtggcccgtcacttcatccagcgc
tggaacttcacgaagattatgaagtcaaaatatcggtccctttcttaccctttcctgctt
cccaaatctcaaacaacagcccatgagttgaaataccaagtgcctgcgtccgtccatgcc
aatgtacagttgctgcgctctgctgctgattggtcggccggaataaagtaccacgaagag
tccatccacgctgcctacctccacgtgatagagaacagcaagcactatatctatatagaa
aaccagtttttcataagttgtgctgatgacaaagttgtgttcaacaagattggtgatgcc
attgcacagaggatactgaaagctcacagggaaagccagagataccgggtgtatgtggtg
ataccgctgctgccaggatttgaaggcgacatctccacgggaggaggaaacgccctgcag
gcaatcatgcacttcaactacaggaccatgtgcagaggagaaaattccatccttggccag
ctaaaagcaaagcttggcaatcagtggataaattacatatcattctgtggccttagaaca
catgcagagcttgaaggcaacctcgtcactgagctcatctatgtccatagcaagttgcta
attgctgatgacaacaccgttattattggctctgccaacataaatgaccgaagcatgctg
gggaagcgtgacagtgaaatggctgtcatcgtgcaggacacagagacagtcccttcggtg
atggatggagaagagtaccaggctggccgcttcgcccagggacttcggctgcaatgcttc
agggttgtccttggctatctttctgaaccaagtgaaaacattcaggatccagtgagtgac
aaattcttcaaggaggtgtgggttgcaacagcagctcgaaatgctacaatttatgataag
gtgttccggtgccttcccaatgatgaagtacacaatttaattcaattgagagactttata
accaagcccgtcttagcaagggaagatcccattagagctgaggaagaactgaaaaagatc
cgtgggttcttagtgcaattccccttttatttcctgtctgaagaaagcctcctgccttct
gttggaaccaaagaagccatagtgcccacagaggtttggacttaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161193
Entry
111161193         CDS       T05871                                 

Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00564  Glycerophospholipid metabolism
elk00565  Ether lipid metabolism
elk01100  Metabolic pathways
elk04014  Ras signaling pathway
elk04024  cAMP signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04144  Endocytosis
elk04666  Fc gamma R-mediated phagocytosis
elk04724  Glutamatergic synapse
elk04912  GnRH signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk05200  Pathways in cancer
elk05212  Pancreatic cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111161193
   00565 Ether lipid metabolism
    111161193
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111161193
   04072 Phospholipase D signaling pathway
    111161193
   04071 Sphingolipid signaling pathway
    111161193
   04024 cAMP signaling pathway
    111161193
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111161193
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    111161193
  09152 Endocrine system
   04912 GnRH signaling pathway
    111161193
   04928 Parathyroid hormone synthesis, secretion and action
    111161193
  09156 Nervous system
   04724 Glutamatergic synapse
    111161193
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161193
   05231 Choline metabolism in cancer
    111161193
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111161193
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     111161193
Membrane trafficking [BR:elk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    111161193
 Endosome - Golgi transport
  Others
   Others
    111161193
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 111161193
NCBI-ProteinID: XP_022380476
UniProt: A0A2Y9L3K3
LinkDB
Position
Unknown
AA seq 933 aa
MAATPASLFPSGGDLDSSQLHMEPDELDTLKEGEDPADRMHPFLAIYDLQPLKMRPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGAFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFGAAHPPAREAADREIPSLPRVAPEGSSRHASSKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSRLSFIPDLGSKGLEGVIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVRVGKRSTEARYGVRIDTSHRSLILKCGSYRQAR
WWGQEITELAQGPGRDFIQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILQAQEEIF
ITDWWLSPEIYLKRPAHSDDWRLDIMLKRKAEEGVRVSVLLFKEVELALGINSGYSKRAL
MLLHHNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDPSR
PAAPKPPPPGSDSPGSPDLSQNQLFWLGKDYSNLITKDWVQLDRPFEDFIDRETMPRMPW
RDVGVAVHGLPARDLARHFIQRWNFTKMTKAKYKTPMYPYLLPKSTSTADQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVFNKVGDE
IVDRILKAHKHGQCFRVYVLLPLLPGFQGDITTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYMSICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIQDTEMEPSLMDGREYQAGRFALSLRKHCFSVILGADARPDLDLQDPVCD
DFFQLWQDTAENNANIYEQIFRCLPSNATRSLRALREYVAAEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEEENLLPPLGSKEGMMPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggcggcgacccccgcgagcctcttcccctctgggggcgacctggactccagccagttg
catatggagcccgatgagttggacactctaaaggagggagaggacccagctgaccggatg
cacccgtttctggccatctacgacctgcagcctctgaaaatgcgccccttggtgttcgcc
cctggggtcccggtcaccgcccaagtggtgggcactgaaagatacaccagtggctccaag
gtgggaacctgcaccctgtactctgtccgcttgacgcacggcgcctttacctggacgacc
aagaagaagttccggcattttcaggagctgcaccgggacctcctgagacacaaagtcttg
atgagtctgcttcctctggcgcgctttggtgcggcccaccctccagcccgggaggcagcc
gaccgagagataccctctctacctcgcgtggctcccgagggctccagcagacatgcatcc
agcaaacagaagtacctggagaattaccttaaccgcctcctgaccatgtctttctaccgc
aactaccatgccatgacagaattcctggaagtcagccggctgtcctttatcccagacctt
ggctccaaaggactggagggagtgatccggaagcgctccgggggccaccgagtccctggc
ctcacgtgctgtggccgagaccaagtgtgttaccgctggtccaagaggtggctggtggtg
aaggactccttcctgctgtacatgtgcctcgagacgggcgccatctcctttgttcagctc
ttcgaccctggcttcgaggtgcgcgtggggaagaggagcacagaggcccgctacggggtc
aggatcgacacctcccacaggtccctgattctcaagtgtggcagctaccggcaggcacgg
tggtggggccaggagatcacggagctggcacagggcccgggcagggacttcatacagctg
caccgacatgacagctacgccccgccccggcctgggaccctggcccggtggtttgtgaat
ggggcgggttactttgccgctgtggcggatgccatcctgcaagctcaagaggagattttc
atcacagattggtggctgagtccggagatttacctgaagcgtccggcccattcagatgac
tggagactggacattatgctcaagaggaaggcggaggaaggtgtccgtgtgtctgtcctg
ctgtttaaggaagtggagttggccttgggcattaacagtggctatagcaagagagcccta
atgttgctgcatcacaacataaaggtcatgcgccacccggaccaggtgaccctgtgggcc
catcatgagaagctcttggtcgtggaccaagtagtggccttcctgggggggctggacctc
gcctatggccgctgggatgacctgcactaccgcctgactgacctcggggacccatccagg
ccagcggccccaaagcctcccccgccaggctccgactctccaggcagcccagacctctca
caaaatcaactcttctggctgggcaaagactacagcaatcttatcacgaaggactgggtg
cagctggaccggccttttgaggatttcattgacagggagaccatgccccggatgccatgg
cgggacgttggggtggctgtgcacggtctcccagcccgggacctggcccgacacttcatc
caacgctggaacttcaccaagatgaccaaggccaagtataagacacccatgtacccctac
ctgctgcccaaatccaccagcacagcagaccagctccccttcacgctccctgggggccag
tgcaccaccgtacaggtcttgcggtctgtggaccgctggtcagcagggactttggagaac
tccatcctcaacgcctacctgcacaccatcagggagagccagcactttctgtacatcgag
aatcagttcttcattagctgctccgatgggcggaccgttttcaacaaggtgggggatgag
attgtggacagaatcctgaaggcccacaaacatgggcagtgcttccgagtctacgtgctt
ttgcccctgctgcctggtttccagggtgacatcactacaggtggtgggaactctatccag
gccattctgcacttcacctacaggaccctgtgccgtggggagtactcgatcctacatcgc
ctcaaagcagccatggggacagcgtggagggactatatgtccatctgtgggctgcgcacc
cacggagagctgggcgggcacccagtctcagagctcatctatatccacagcaagatgctc
atcgcagacgaccggacggtcatcattggctctgcgaacatcaatgaccgtagcttgctg
ggcaagcgggacagtgagctagccgtgctgatccaggacacagagatggagccctccctc
atggacggcagggaatatcaggcgggcaggtttgccttgagtttgcggaagcattgcttc
agtgtgattcttggggcagatgcccggccggacctggacctccaagaccctgtctgtgat
gactttttccagctgtggcaagacacagctgagaacaacgccaacatctatgagcagatc
ttccgttgcctgccatccaacgccacccgctccctgcgggcactccgggagtacgtggcc
gcagagcccctggccacggtcagcccacctctggccaggtctgagctcacccaggtccag
ggtcacctggtccactttcccctcaagttcctggaggaagagaatttgctgccgcccctg
gggagcaaggaaggcatgatgcccctcgaagtgtggacatag

DBGET integrated database retrieval system