KEGG   Enhydra lutris kenyoni (northern sea otter): 111150586
Entry
111150586         CDS       T05871                                 

Definition
(RefSeq) ETS domain-containing protein Elk-1 isoform X1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04510  Focal adhesion
elk04910  Insulin signaling pathway
elk04912  GnRH signaling pathway
elk04921  Oxytocin signaling pathway
elk05140  Leishmaniasis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05213  Endometrial cancer
elk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111150586
   04012 ErbB signaling pathway
    111150586
   04014 Ras signaling pathway
    111150586
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111150586
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111150586
   04912 GnRH signaling pathway
    111150586
   04921 Oxytocin signaling pathway
    111150586
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111150586
   05205 Proteoglycans in cancer
    111150586
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111150586
   05213 Endometrial cancer
    111150586
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111150586
   05161 Hepatitis B
    111150586
   05163 Human cytomegalovirus infection
    111150586
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111150586
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111150586
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    111150586
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 111150586
NCBI-ProteinID: XP_022363798
UniProt: A0A2Y9JS02
LinkDB
Position
Unknown
AA seq 484 aa
MMLLWEQKRRQDGKKGLLLLLTFATSCVHSLSALSCLPSRYPWDGVSTPPAMDPSVTLWQ
FLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYD
KNIIRKVSGQKFVYKFVSYPEVARCSTEDCPPQPEVSVTSTVANVATTAVHAAPGDTASG
KPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPASVLPNTAPSGA
AVPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAQNPKSEELNVEPGSGRSLPPEVK
VDGPKEELEPAVGGEAGFVQEAAKAGPEVPPAEGVPARLPAVVMETAAPVGGLPASTASS
TEIAQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAPGPALTPSLLPTHTLTP
VLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPG
PQKP
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgatgttgctttgggaacagaagcggagacaagatggaaagaaaggactcctcctcctg
ttgacctttgccacctcctgtgttcacagcctctcagctctgagctgtctgccctccagg
tacccctgggatggcgtgagcactccgccagcgatggacccctctgtgacgctgtggcag
tttctgctgcagctgctgagagagcagggaaacggccacatcatctcgtggacctcacgg
gatggcggtgagttcaagctggtggatgctgaggaggtggcccggctgtgggggctgcgt
aagaacaagaccaacatgaattacgacaagctcagccgggccctgcgttactactatgac
aagaacatcatccgcaaagtgagcggccagaagtttgtctacaagtttgtgtcctaccct
gaagtcgcgaggtgctccactgaggactgcccgccccagcccgaggtgtctgtcacctct
actgtggcaaatgtggccaccactgctgtacatgctgcccccggggacacagcctctggg
aaaccaggcacacccaagggtgcaggaatggcaggccccgggggcttggcgcgcagcagc
cggaatgagtacatgcgctcgggcctctactccaccttcaccatccagtccttgcagcca
cagccgccccctcatcctcggcctgcctccgtgctccccaacaccgccccttcgggagca
gcagtgcccccgtctgggagcaggagcactagtcccagccccttggaggcctgcctggag
gcggaggaggctggcctccctctgcaggtcatcctgaccccacccgaggcccagaatcct
aaatcagaagagctgaatgtggagcccgggtcgggcaggtcactgcccccagaagtgaaa
gtggacgggcccaaggaagagttggaacccgcagtcggtggggaggcggggtttgtgcag
gaagccgctaaggccgggccggaagtccctcctgcggagggcgtgccagcccggctgccc
gcggtcgtcatggagactgcagcgccggtgggcggcctcccggcttccactgcttccagc
acagagattgcccagcctcagaagggccggaagccccgggacctggagcttccactcagc
cccagcttgctgggtgggccaggacccgaacggactccaggatcgggaactggctctggg
ctgcaggcgccggggccagcgctgaccccgtccctgctacctacgcacacattgaccccg
gtgctgctgacgcccagctcgctgccccccagcattcacttctggagcaccctgagtccc
attgcaccccgtagcccagccaagctctccttccagtttccgtccagtggcagcgcccag
gtgcacatcccttccatcagcgtggatggcctctcaacccccgtggtgctctccccaggg
ccccagaagccatga

DBGET integrated database retrieval system