KEGG   Enhydra lutris kenyoni (northern sea otter): 111150674
Entry
111150674         CDS       T05871                                 

Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04020  Calcium signaling pathway
elk04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111150674
   04020 Calcium signaling pathway
    111150674
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111150674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:elk04040]
    111150674
Ion channels [BR:elk04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111150674
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 111150674
NCBI-ProteinID: XP_022363912
UniProt: A0A2Y9JSA3
LinkDB
Position
Unknown
AA seq 2318 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFTNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLGLGL
EKCEEERISRGGSLKGDGGDLSSALDNQRSPLSLGKREPPWLARPCHGHCDPTQQEAGGG
ETMVTFEDRARHRQSQRRSRHRRVRTEGKELSSTSRSRSASQERSLDEGVPTDGEKDCES
RGSHTGKEPTIQEEERSQDLRRTNSLMVPRGSGLAGALDEDNTPLVRPQPELEMGKDTVL
TEQEAEGSSEQALLGDVQLDIGRAISQSEPDLSCTMADTDKANTDSTSVTVAIPDVGPLV
DSTVVHISNKTDGEASPLKEAEIKEEEEEVEKKQQKKEKRETGKAMVPHSSMFIFSTTNP
IRRACHYIVSLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEM
VIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLR
VLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDS
SKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHS
VDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEK
NERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYS
APCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILTD
SKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIY
AIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPD
TTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHL
DEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDM
TVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKAS
DLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYL
QQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQSSNH
GIYLPSDTQEHTGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMER
SSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCN
SEERGTQADWESPERQQSRSPSEGRSQTPNRPGTGSLSESSIPSISDTSTPRRSRRQLPP
VPPKPRPLLSYSSLLHHTGSISPPADGSECGSPLASQALESTEASLVESSSCRHTPQGRH
TPQGQHPSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHS
WQMPNGHYRRRRRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 6957 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaaccccggtgccggcctcggggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcctgtccggcag
aactgtttcaccgtcaacagatccctcttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccatttgagtacatgattttggccaccatcatt
gccaactgcattgtcttggccctggaacagcatcttcctgaggatgacaagaccccgatg
tcccgcagactggagaagacggaaccgtatttcattgggatcttttgctttgaagctggt
atcaaaattgtggccctggggttcatcttccataagggctcgtacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggtatcctggccacggcaggaacccacttc
aacacacatgtggacctgaggaccctccgggctgtgcgtgtcctgaggcccctgaagctc
gtgtcggggatacctagcctgcagattgtgctgaagtccatcatgaaggccatggtgcct
cttctgcaaattggtcttctgctcttctttgccatcctaatgtttgctatcattggcttg
gagttctacagtgggaagctgcaccgcgcgtgtttcacaaacaattcaggtattctggaa
ggattcgacccccctcacccgtgtggtgtgcagggctgccccgctggttacgaatgccga
gactggattggccccaacgatgggatcacccagtttgataacatcctttttgctgtgctg
accgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaactggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaacctagttctgggagtgctctccggggaatttgccaaagagagagagaga
gtggagaaccggagagcgttcatgaaactgcggcggcaacagcagattgagcgcgagctg
aatgggtaccgcgcctggatagacaaagcagaggaagtcatgcttgccgaagaaaataaa
aattctgggacgtcagccttagaagtgcttcgaagggcaaccatcaaaaggagccggaca
gaggccatgactcgagactctagcgatgagcactgcgtggatatctcctctgtgggcacc
cctctcgcccgagccagcatcaaaagtacaaaggtggatggggcctcctatttccggcac
aaagaaaggcttctgcgcatctctatacgccacatggttaaatcccaggtgttctactgg
atcgtgctgagcctcgtggctctcaacaccgcctgtgtggccatcgtccatcacaaccag
ccccagtggctcacgcatcttctctactatgcagagtttttgtttctgggactgttcctc
ttggagatgtccctgaagatgtatggcatggggcctcgactttattttcactcttcattc
aactgctttgattttggggtcacagtggggagtatctttgaagtggtctgggcaatcttc
agacctggtacatcttttggaatcagtgtcttgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatctctgcgaaatctggtggtctccttgatgagttctatg
aagtctatcatcagtttgctgttcctcctcttcctcttcatcgttgtctttgctctccta
ggaatgcagctgtttggaggcaggtttaactttaatgatgggactccttcagcaaacttt
gacaccttccctgcagccatcatgaccgtatttcagatcctaacaggggaggactggaat
gaggtgatgtacaatgggatccgctcccagggtggggtcagctcaggcatgtggtcagct
atctatttcattgtgctcaccttgtttggaaactacacactgctgaacgtgttcttggcc
attgctgtggacaatctggccaatgcccaagagctgaccaaggatgagcaagaagaagag
gaggctttcaaccagaaacatgcattgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttctatcgaaagagacagaaggcgaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcaccacatgtcggtgtgggagcag
cgcaccagtcagctgcgaaggcacatgcagatgtccagccaggaggccctcaataaagag
gaggccccaccaatgaaccccctcaaccccctcaacccgctgagccccctcaacccactc
aatgcccaccccagcctctaccggagacccaggcccatcgagggtctgggcctgggcctg
gagaagtgtgaggaggagcgcatcagccgcggggggtccctcaagggggatggaggggac
ctgtcaagtgccctggacaaccagaggagccccctgtccctgggcaaacgggagccacca
tggctggcccggccctgtcatggccactgtgacccgacccagcaggaggctgggggaggg
gagaccatggtgaccttcgaggaccgcgccaggcacaggcagagccagaggcgcagccgg
caccgtcgcgtcaggacagaaggcaaggagctctcctccacctctcggagccggtcggcc
agccaggagcggagtctggatgaaggggtgcccaccgacggggagaaggactgcgagtcc
aggggcagccacacgggcaaggaacccacaatccaggaagaggagagaagccaagacttg
aggaggaccaacagtctcatggtgcccagaggctccgggctggcaggagccctcgatgag
gacaacacgcctctggtccggccccagccagagctggaaatggggaaggacacggtgctg
acagaacaggaggcggagggcagcagcgagcaagccctgctgggcgacgtgcagctggat
ataggccgggccatcagccagagtgagcctgacctctcctgcaccatggctgacacagac
aaggccaacaccgacagcaccagcgtcaccgtcgccatcccagacgtgggccccttggtg
gactcaactgtggttcacattagcaacaagactgatggagaagccagtcccttgaaggag
gcagaaatcaaagaggaagaagaggaggtggaaaagaagcagcagaagaaggagaagcgt
gagacaggcaaagccatggtgccccacagctccatgttcatcttcagcaccaccaacccg
atccgcagggcctgccactacatcgtgagtctgcgctactttgagatgtgcattctcctg
gtgatcgcggccagcagcatcgccctggcagccgaggaccccgtcctgaccaactctgag
cgcaacaaagtcctgaggtattttgactatgttttcactggcgtgttcacctttgaaatg
gtcataaagatgatagaccaaggcttgatcctgcaggacgggtcctacttccgcgatttg
tggaacatcctggacttcgtggtggtggttggcgcattggtggcctttgctttggcgaac
gctctgggaacaaacaaggggcgagacatcaagaccatcaaatctctgagggtcctccga
gttctgaggccattgaagaccatcaagcgcttgcccaagctcaaggctgtctttgactgt
gtggtaacctccttaaagaacgtcttcaacatcctcattgtctacaagctcttcatgttc
atctttgctgtcattgcggttcagctcttcaagggaaaattcttttattgcacagacagt
tccaaagacacagagaaggagtgcataggcaactatgtagatcatgaaaaaaacaagatg
gaggtgaaaggccgggaatggaaacgccatgaattccactatgacaacattatctgggcc
ctgctgaccctcttcaccgtctccacaggagaaggatggcctcaagtcctacagcattct
gttgacgtgacagaggaagaccgaggaccaagccgcagcaaccgcatggagatgtccatc
ttttacgtggtctacttcgtggtcttccctttcttctttgtcaacatctttgtggctctc
atcatcatcaccttccaggagcaaggggacaagatgatggaggagtgcagcctggagaag
aacgagagggcatgcatcgactttgccatcagcgccaaacctctcacccgctacatgcca
cagaacaggcatacattccagtaccgcgtctggcacttcgtggtgtccccatcctttgag
tacaccatcatggccatgatcgccctgaacaccgtcgtgctgatgatgaagtactactct
gctccctgtacctacgaactggccctgaagtacctgaatattgccttcaccatggtgttc
tccctggagtgtgtcctaaaagtcatcgcattcggcttcttgaactatttccgagacacc
tggaatatctttgacttcatcactgtgattggcagtatcacagaaatcattctgacagac
agcaagctggtgaacaccagtggcttcaacatgagctttctgaagctcttccgagccgcc
cgcctcatcaagcttctccggcagggctacaccatccgtattttactctggaccttcgtg
cagtcctttaaggccctcccctacgtctgccttttgattgccatgcttttcttcatctat
gccatcattgggatgcaggtgtttggaaacataaaattagatgaggagagtcacatcaac
cgacacaacaacttccggagtttcttcgggtccctcatgttactcttcaggagtgccaca
ggcgaggcctggcaggagataatgctgtcatgcctcggggagaaaggctgcgagccagac
accactgcgccttcggggcagaacgagaatgagcgctgtggcacagatctggcctacgtt
tactttgtctccttcatcttcttctgctccttcttgatgctcaacctgttcgtggccgtc
atcatggacaactttgagtacctgactcgggactcctccatcttagggcctcaccacttg
gacgaatttgtccgcgtctgggcagaatatgacagagctgcatgtggccgcatccattac
actgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgt
ccctccaaagtggcatataagagattggtcctgatgaatatgccagtggctgaggacatg
acggtccacttcacctccacactgatggctctgatccggacagctctggacattaagatt
gccaaaggtggtgcagacagacagcagctagactcggagctgcaaaaggagaccctggcc
atctggccccacctgtcccagaagatgctagatctgcttgtgcccatgcccaaagcctca
gacctgactgtgggcaaaatctatgccgcgatgatgatcatggactactacaagcagagt
aaggtgaagaagcagaggcagcagctggaagagcagaaaaatgcacccatgttccagcgc
atggagccctcatctctgcctcaggagatcattgctaatgccaaagccctgccctatctc
cagcaagaccctgtttcaggcctgagtggccgtagtggatacccttcgatgagtccgctc
tccccccaggaaatattccagttggcttgtatggacccggccgatgatggacagttccag
gaacagcagtctctggagccagaggttagtgaattaaaaagcgtgcagtcttctaaccat
ggcatctaccttccttcggacacccaggagcatacgggatctgggagggcatcctctatg
ccacgcctgactgtggatccccaggtggtgacagatcccagctccatgagacgttcattt
tctacaattcgggataagcgttcaaattcctcatggctggaggaattctccatggagaga
agcagtgaaaacacctataagtcgcgtcgtcggagttaccactcctcgctgaggctgtca
gctcatcgcctgaattctgactcaggccacaagtctgacacccaccgctcagggggcaga
gagcggggacggtcgaaagagcgaaagcatcttctctctcccgatgtctcccgctgcaac
tcagaggaacgagggacccaggccgactgggagtccccagagcgccagcagtccaggtct
cccagtgagggcaggtcacagacccccaacagaccgggcacaggttccctgagtgaaagc
tccatcccctccatctctgacaccagcaccccaagaagaagtcgccggcagctcccaccg
gtcccccccaagcctcggcccctcctctcctacagctcccttctgcaccacaccgggagc
atctctccgccagcggacgggagcgagtgcggctccccgctggcctcgcaggcgctggag
agcacggaggccagcctggtggagtcttccagctgccggcacaccccgcagggccggcac
accccgcagggccagcacccctccccacagcgctacatctccgagccctacctggccctg
cacgaagactcccacgcctcggactgcggcgaggaggagacgctcaccttcgaagccgcc
gtggccaccagcctgggccgctccaacaccatcggctccgcaccgccactgcggcacagc
tggcagatgcccaacgggcattatcggcggcggcggcgtggggggcccgggccgggcgtc
atgtgtggggctgtcagcgacctcctgagtgacacggaagaagacgacaagtgctag

DBGET integrated database retrieval system