KEGG   Enhydra lutris kenyoni (northern sea otter): 111150791
Entry
111150791         CDS       T05871                                 

Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00590  Arachidonic acid metabolism
elk01100  Metabolic pathways
elk04064  NF-kappa B signaling pathway
elk04370  VEGF signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04668  TNF signaling pathway
elk04723  Retrograde endocannabinoid signaling
elk04726  Serotonergic synapse
elk04913  Ovarian steroidogenesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05140  Leishmaniasis
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05204  Chemical carcinogenesis
elk05206  MicroRNAs in cancer
elk05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111150791
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111150791
   04064 NF-kappa B signaling pathway
    111150791
   04668 TNF signaling pathway
    111150791
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111150791
   04657 IL-17 signaling pathway
    111150791
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    111150791
   04913 Ovarian steroidogenesis
    111150791
   04921 Oxytocin signaling pathway
    111150791
  09156 Nervous system
   04726 Serotonergic synapse
    111150791
   04723 Retrograde endocannabinoid signaling
    111150791
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111150791
   05206 MicroRNAs in cancer
    111150791
   05204 Chemical carcinogenesis
    111150791
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111150791
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111150791
   05022 Pathways of neurodegeneration - multiple diseases
    111150791
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111150791
   05167 Kaposi sarcoma-associated herpesvirus infection
    111150791
   05165 Human papillomavirus infection
    111150791
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111150791
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     111150791
SSDB
Motif
Pfam: An_peroxidase EGF
Other DBs
NCBI-GeneID: 111150791
NCBI-ProteinID: XP_022364100
UniProt: A0A2Y9K334
LinkDB
Position
Unknown
AA seq 604 aa
MLARALLLCAALALCGAANPCCSNPCQNQGVCMSIGFDQYMCDCSRTGFYGENCSTPEFL
TRVKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLRNVIMRYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPGFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKY
QVINGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFVYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYASFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTTFNVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgcttgctcgcgccctgctgctctgcgccgctctggcgctctgcggtgcagcgaatcct
tgctgttccaacccatgtcaaaaccaaggtgtgtgtatgagcataggatttgaccagtac
atgtgtgactgctctcgaacaggattctatggtgaaaactgttcaacacctgaatttctg
acaagagtaaaattattcctgaaacccactccgaatacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgcgaaatgtaattatgaga
tacgtgttgacatccaggtcacatttgattgagagtccaccaacttacaatgtggactat
ggctataaaagctgggaagccttttctaatctctcctactataccagagctcttccccct
gtggcggatgactgtccaacacccatgggtgtgaaaggcaagaaagagcttcctgattct
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgatccccagggcaca
aatatgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatcat
aagcgagggccaggtttcaccaaaggactgggccatggggtggacttaaaccatgtttat
ggggaaactttggatagacaacataaactgcgcctcttcaaggacggaaaaatgaaatat
caggtaatcaatggagaggtgtatcctcccacagtcaaagatactcaggtggagatgatc
tacccaccccatgttcctgaacacctgcggtttgctgtgggccaggaagtcttcggactg
gtgcctggtctgatgatgtatgccacgatctggctgcgggagcataacagagtgtgtgat
gtgctcaaacaggagcatccagagtgggatgatgagcgtctgttccagacgagcaggctc
atattgataggagaaaccattaagattgtgattgaagactatgtgcagcacttgagtggc
tatcacttcaagctgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgcattgctgctgagtttaacacgctctaccactggcacccccttctgcccgacacc
ttgcaaatagatgaccaggagtacaatttccaacagtttgtctacaacaactcgatactg
ctggaacatgggcttacccagtttgtggaatccttcagcaggcaaattgctggcagggtt
gctggtggtaggaatgttccagctgcagtacaacaagtagcaaaggcctcaattgaccag
agcagacagatgaagtaccagtctctgaatgagtaccgcaaacgctttcggctgaagccc
tacgcgtctttcgaagaacttacaggagagaaggaaatggctgcggggttagaggccctt
tatggagatattgatgccatggagctgtatccagccctcctggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaaatgggagcaccattctccttgaaaggactc
atgggtaatcccatctgttcgcctgactactggaagcccagtactttcggtggagaagta
ggctttaaaatcatcaacactgcctccattcagtctctcatctgcaataacgtgaagggc
tgtccttttactacattcaatgttcaagacccccagctcaccaaaacagtcaccattaat
gcaagctcttcacactccggactagatgacatcaatcccacagtcctgctaaaagaacgg
tccaccgaactgtag

DBGET integrated database retrieval system