KEGG   Enhydra lutris kenyoni (northern sea otter): 111150846
Entry
111150846         CDS       T05871                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase RFWD2 isoform X1
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
elk04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111150846
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111150846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111150846
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111150846
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    111150846
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     111150846
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf_C2H2_10 zf-RING_10 zf-RING_11 zf-RING_4 Prok-RING_4 DZR zf-Nse
Other DBs
NCBI-GeneID: 111150846
NCBI-ProteinID: XP_022364185
UniProt: A0A2Y9K3C7
LinkDB
Position
Unknown
AA seq 729 aa
MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSAAVAAAASGGAAQAAGSGGLG
GPARPVLVAAAVSGSGGGAVSAGLSRLSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNG
LINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDH
LYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDLLGTDQDNLDLANVNLML
ELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMSGL
YSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTA
HFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSS
IVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQDAVDIHYPENEMTCNSKISCISWSSYH
KNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWS
TNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAV
SYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENN
SLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQ
GTIKVLELV
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtctgggagccgccaggccgggtcgggctccgccgggaccagccctggctcctcggcg
gcctcctcggtgacttccgcctcctcgtccttgtcctcttccccgtcgcccccttccgcg
gcggtggcagcggcggcgtccggcggagcggcccaggccgcgggttcgggcggcctcggg
ggcccggcgcggcctgtgctggtggcggccgctgtgtccggcagcggcggcggggcggtg
tccgcgggcctgtctcggctcagctgcgcggccaggcccagcgccggcgtgggagggagc
agctccagcctcggcagcggcagcaggaagagacctctgctcgcccccctgtgcaacggg
ctcatcaattcctacgaggacaaaagcaacgacttcgtgtgccctatctgctttgatatg
attgaggaagcatacatgacgaaatgtggccacagcttttgctacaagtgtattcatcag
agtttggaggataataatagatgtcccaagtgtaactatgttgtggataatattgaccat
ctgtatcctaatttcttggtgaatgagctcattctcaaacagaagcaaagatttgaggaa
aagaggttcaaattggaccactcagtgagtagcaccaatggccacaggtggcaaatattt
caggatttgttgggaactgatcaagataaccttgatttggccaatgtcaacctcatgttg
gaattactagtgcagaagaagaaacaactggaagcggaatcacatgcagcccaactacag
atccttatggaattcctcaaggttgcaagaagaaataagagagagcaactggaacagatc
cagaaggagctgagtgttttggaagaggatattaaaagagtggaagaaatgagcggcttg
tactctcctgtcagtgaggatagcacagtacctcaatttgaagctccttctccatcacac
agtagtattattgattccacagaatacagccagcctcctggtttcagtggcagttctcag
acaaagaaacagccttggtataacagcacattagcatcaagaagaaaacgactcactgct
cattttgaagacttagagcaatgttacttttctacaaggatgtctcgtatttcagatgat
agtagaactgcaagccagttggatgaatttcaggaatgcttgtctaagtttactcgatac
aattcagtacgacctttggctacattgtcatatgctagtgatctgtataatggttccagc
atagtctctagtattgaatttgaccgggattgtgactattttgcaattgctggggttaca
aagaaaattaaagtctatgaatatggcacagtcattcaggatgcggtggatattcattac
cctgaaaatgaaatgacctgcaattccaaaatcagctgtatcagttggagtagttaccat
aagaatctgttagccagcagtgattatgaaggcaccgtcatcctatgggatggatttaca
ggacagaggtcaaaagtttatcaggagcacgagaaaaggtgttggagtgttgactttaat
ttgatggatcctaaactcttggcttctggttctgatgatgcaaaagtgaagctatggtct
accaacctagacaactcagtggcaagcattgaggcgaaggctaatgtgtgctgtgttaaa
ttcagcccctcttctcgataccatttggctttcggctgtgcagatcactgtgtccactac
tatgatcttcgtaacactaagcagccaatcatggtattcaaaggacaccgaaaagcagta
tcttatgcaaagtttgtgagtggtgaggaaattgtttctgcctcaacagatagccagcta
aagctgtggaatgtagggaaaccatactgtctacgttccttcaagggtcacatcaatgaa
aaaaactttgtaggccttgcttccaatggtgattatatagcttgtggaagtgagaacaac
tctctttatttgtactataaaggactttctaagactttgctaacttttaagtttgatacg
gtcaaaagtgttctggataaagaccgaaaagaagatgatacaaatgaatttgttagtgct
gtgtgctggagggcactgccagatggggagtccaatgtgctgattgctgctaacagtcag
ggtacgattaaggtgctggagttggtatga

DBGET integrated database retrieval system