KEGG   Enhydra lutris kenyoni (northern sea otter): 111150850
Entry
111150850         CDS       T05871                                 

Definition
(RefSeq) RAB6-interacting golgin
  KO
K19748  RAB6-interacting golgin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111150850
Membrane trafficking [BR:elk04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    111150850
SSDB
Motif
Pfam: Transcrip_act
Other DBs
NCBI-GeneID: 111150850
NCBI-ProteinID: XP_022364194
UniProt: A0A2Y9JXD8
LinkDB
Position
Unknown
AA seq 397 aa
MCLGRRVGSRGSEVWAFWGRRQPRRMARGWAGFSEEELRRLKQAKDPFEPQRRLPVKKSR
QQLQREKALQEQSQKLGLQDGSSSVPPEQLLSAPKPSFNSPEPQSSLRVPPGPLTLASPV
GDGKPQGTESPPRELGLENSHDSHKNAEVLPPKPDCKMEKKKVELQEKSRWEVLQEEQRL
MEEKNKRKKALLAKAIAERSKRTQAETLKLKRIQKELQALDDMVSADIGILRNRIDQASL
DYSCARKRYDRAEAEYVAAKLELQRKTETKERLTEHLCTIIQQNELRKAKKLEELMQQLD
VRADEETLELEVEVERLLHEQGTGAGKQEPHLERLFQPSGKSVTLGFAEESKNHQEHAAS
LKIDEQCENPSSIPLQNPGQNQEIKTPVKAISAALTT
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtgcctgggccgtcgcgttggcagtcggggctccgaggtctgggcgttctgggggcgc
cggcagccgaggcgcatggcgcggggttgggccggcttctctgaggaggagctgaggcga
ctgaagcaggctaaagatccatttgaaccacagcgacgtctccctgtgaagaaaagtcga
caacaacttcagcgggaaaaagctcttcaagagcaaagccaaaaacttggacttcaagat
ggatcaagctcagtacctccagagcagctgctttctgcaccaaaaccaagctttaatagt
ccagaaccacagtcttctctccgggttcctcctggtcctcttacacttgcctctcctgtc
ggtgatggaaaaccacaggggactgaaagtccaccaagggaactgggacttgagaattcc
catgatagtcacaaaaacgccgaggttctgcccccaaagccagattgcaaaatggaaaaa
aagaaagtggaattgcaagaaaagtctcgttgggaagtcctccaggaggaacaacggcta
atggaagagaaaaataaacgtaagaaagctcttttggctaaagctattgcagaaagatct
aaaagaactcaagcagagaccttgaaactaaagcggattcaaaaggagttacaggcacta
gatgacatggtgtcagctgacattggaatcctcagaaaccggatcgatcaggccagcctc
gattattcctgtgcgcggaagcgctatgacagggctgaagcagagtatgtcgcggcgaag
ctggagctacagcgcaagactgagaccaaagagcgactcactgagcacctctgtacgatc
atacagcagaatgagctccgcaaggctaagaagttggaagagttgatgcagcagctggat
gtacgagctgatgaggagactctggagctcgaggtggaggtggagagattgctgcatgag
caaggaaccggagcagggaaacaggagcctcacttggagaggctgttccagccttctggg
aagagtgtgacattaggatttgccgaagagagcaaaaatcaccaagaacacgccgcttcc
ctaaagatagatgaacagtgtgaaaatcccagcagcattccccttcaaaatccaggccaa
aatcaagaaattaaaactcctgtaaaggccatttcagctgctctgaccacatga

DBGET integrated database retrieval system