KEGG   Enhydra lutris kenyoni (northern sea otter): 111150994
Entry
111150994         CDS       T05871                                 

Definition
(RefSeq) protein Mdm4
  KO
K10127  protein Mdm4
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
elk05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111150994
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111150994
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111150994
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    111150994
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB Prok-RING_4 Cript
Other DBs
NCBI-GeneID: 111150994
NCBI-ProteinID: XP_022364384
UniProt: A0A2Y9JXY1
LinkDB
Position
Unknown
AA seq 492 aa
MTSLSTSAQCSTSDSACRISPEQTSQVRPKQPLLKILQAAGAQGEMFTVKEVMHYLGQYI
MVKKLYDQREQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLITLASATTDAAQTL
ALAQDHSMDIPSQDQLKQSAEESSSSRKRMEEGNIPALPTSHHKCRSSREDEDFIKNLTQ
DETSKLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDIGTAIVSDTTDDLWF
LNESVSEQFGVGIKVEAADTEETSEEVGKVRDKRVIEAGKNDDLEDSKSLSDDTDVEVTS
EDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKKENEGIDV
PDCRRTISAPVVRPKDVCTKEEKKPRLFDPCNSVEFLDLAHSSESQETISSMGEQSDNLF
EQRTDTENMEDCRNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICK
KEIQLVIKVFIA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgacgtcactttccacctctgcccagtgttcaacttctgacagcgcttgcaggatctct
ccagaacagaccagtcaggtacgaccaaaacagccacttttgaagattttgcaagcagca
ggtgcacaaggagaaatgttcactgttaaagaggtcatgcattatctcggccagtacata
atggtgaagaagctttatgatcagcgggagcagcatatggtgtattgtggcggagatctt
ttaggagaactgctaggacgtcagagcttctccgtgaaagatccaagccctctctatgat
atgctaagaaagaatcttatcactttagcctctgctactacagatgctgctcagactctc
gctctcgcacaggatcacagtatggatattccaagtcaagaccaactgaagcaaagtgca
gaagaaagttccagttccaggaagagaatggaagaaggcaatattcctgcactgcctacc
tcacatcataaatgcagaagttctagagaagatgaagacttcataaaaaacttaacccaa
gatgagacatctaagctggaccttgggtttgaggagtgggatgtagctgggctgccttgg
tggtttttaggaaacctgaggagcaactatacacctagaagtaatggctcgactgattta
cagacaaatcaggatataggtactgccattgtttcagacaccacagatgacttgtggttt
ttgaatgagtctgtatcagagcagtttggtgtgggaataaaagttgaagctgcagacact
gaagaaacaagtgaagaagtagggaaagtgagagacaaaagggtgattgaagcaggaaaa
aatgatgaccttgaggactctaagtccctaagtgatgatactgatgtagaagttacctct
gaggatgagtggcagtgtactgagtgcaagaaatttaattctccaagcaagaggtactgt
tttcgttgctgggcgttgaggaaggattggtattcggattgttctaagttaacccattct
ctctccacgtctgatatcactgccatacctgaaaagaaggaaaatgaaggaattgatgtc
cccgattgccggagaaccatatcagctccggttgtgagacctaaagatgtatgtacaaag
gaagaaaaaaaacccagactttttgatccttgcaactcggtggaattcttggatttggcc
cacagttctgaaagccaagaaacaatatcaagcatgggagagcaatccgataaccttttt
gaacagagaacagatacagaaaacatggaggattgccggaatctcttgaagccatgtagt
ctgtgtgagaagagaccacgagacgggaacattattcatgggaggacagggcatcttgtc
acttgttttcactgtgccagaagattaaagaaggctggggcttcctgccctatatgcaag
aaagagattcagttggttattaaggttttcatagcgtag

DBGET integrated database retrieval system