KEGG   Enhydra lutris kenyoni (northern sea otter): 111151153
Entry
111151153         CDS       T05871                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04218  Cellular senescence
elk04370  VEGF signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04722  Neurotrophin signaling pathway
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111151153
   04370 VEGF signaling pathway
    111151153
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111151153
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111151153
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111151153
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111151153
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111151153
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111151153
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111151153
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   111151153
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like Choline_kinase
Other DBs
NCBI-GeneID: 111151153
NCBI-ProteinID: XP_022364656
UniProt: A0A2Y9JV22
LinkDB
Position
Unknown
AA seq 403 aa
MLSNSQGQTPPVLFPNPPPPPPPPQPPAPAQHHPPAQPPPLPPQQFPQFHVKSSLQIKKN
AIIDDYKVTTQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHI
VRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYL
HSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGP
EKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEE
VKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMT
SALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgctgtccaactcccaaggccagaccccgccggtgctgttccccaacccgccgccgccg
ccgccgccgccgcagccccccgccccggcccagcatcaccccccggcccagccgccgccg
ctgcccccgcagcagtttccccagttccatgtcaagtcgagcctgcagatcaagaagaac
gccatcatcgacgactacaaggtcaccacccaggtcctgggactgggcatcaacgggaaa
gttttgcagatcttcaataagaggacccaggagaaattcgccctaaaaatgcttcaggac
tgccccaaggcccgccgggaggtggagctgcactggcgggcctcgcagtgcccacacatt
gtgcggatcgtggatgtctacgagaacttgtatgcgggcaggaagtgcctgctgatcgtc
atggagtgtttggacggtggagaactctttagccgaatccaggaccgaggagaccaagcg
ttcacagaaagagaagcgtcagaaatcatgaagagcattggtgaggccatccagtacttg
cactcgatcaacattgcgcatagggatgtcaagcctgagaatctcctatacacctccaaa
aggcccaatgccatcctgaaactcacagattttggctttgccaaggaaaccaccagccac
aactctttgaccactccttgttatacgccgtactatgtggctccagaagtgctgggtccc
gagaagtacgacaagtcctgtgacatgtggtccttgggtgtcatcatgtatatcctgctg
tgtggctatccccccttctattccaaccacggtcttgccatctctccgggcatgaagact
cgcatccgaatgggccagtatgagtttcccaatccagagtggtcagaggtgtcagaggaa
gtgaagatgcttatccggaacctgctgaaaacagagcccactcagagaatgaccatcacg
gaatttatgaaccacccctggatcatgcaatcaacaaaggtccctcaaaccccactgcac
accagccgggtcctgaaggaggacaaggagcggtgggaagacgtcaaggaggagatgacc
agtgccttggccacaatgcgtgttgactacgagcagatcaagataaagaagattgaagat
gcatccaatcctctccttctgaagaggcggaagaaagctcgggccctggaggccgcggcc
ctcgctcactga

DBGET integrated database retrieval system