KEGG   Enhydra lutris kenyoni (northern sea otter): 111151268
Entry
111151268         CDS       T05871                                 

Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04020  Calcium signaling pathway
elk04066  HIF-1 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04510  Focal adhesion
elk04520  Adherens junction
elk04530  Tight junction
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05219  Bladder cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111151268
   04012 ErbB signaling pathway
    111151268
   04066 HIF-1 signaling pathway
    111151268
   04020 Calcium signaling pathway
    111151268
   04151 PI3K-Akt signaling pathway
    111151268
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111151268
   04520 Adherens junction
    111151268
   04530 Tight junction
    111151268
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111151268
   05206 MicroRNAs in cancer
    111151268
   05205 Proteoglycans in cancer
    111151268
   05230 Central carbon metabolism in cancer
    111151268
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111151268
   05226 Gastric cancer
    111151268
   05219 Bladder cancer
    111151268
   05215 Prostate cancer
    111151268
   05213 Endometrial cancer
    111151268
   05224 Breast cancer
    111151268
   05223 Non-small cell lung cancer
    111151268
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111151268
   01524 Platinum drug resistance
    111151268
   01522 Endocrine resistance
    111151268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111151268
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111151268
   04090 CD molecules [BR:elk04090]
    111151268
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111151268
Protein kinases [BR:elk01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   111151268
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   111151268
CD molecules [BR:elk04090]
 Proteins
  111151268
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like CBP_BcsF
Other DBs
NCBI-GeneID: 111151268
NCBI-ProteinID: XP_022364850
UniProt: A0A2Y9K5K2
LinkDB
Position
Unknown
AA seq 1268 aa
MELAAWCRWGLLLALLPSGVVGTQVCTGTDMKLRLPASPETHLDMLRHLYQACQVVQGNL
ELTYLPANASLSFLQDIQEVQGYVLIAHSQVRQVPLQRLRIVRGTQLFEDHYALAVLDNG
DPPEGGPSVAGAAPEGLRELQLRSLTEILKGGVLIQRNPQLCHQDTILWKDIFHKNNQLA
LTLIDTNRSRACQPCSPACKDPHCWGASSGDCQSLTRTVCAGGCARCKGPKPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFEGDPASNTAPLQPEQLRVFEALEEITGYLYISAWPDSLP
DLSVFQNLRVIRGRVLHDGAYSLTLRGLGISSLGLRSLRELGSGLALIHRNAHLCFIHTV
PWDQLFRNPHQALLHSANRPEAECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVKDRYCLPCHSECRPQNGSVTCFGSEADQCVACAHYKDTPFCVSRC
PSGVKPDLSFMPIWKFADEEGTCQPCPINCTHSCADLDERGCPAEQRASPVTSIIAAVVG
ILLAVLVGLVLGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGPAHRRHRSSSTRVSALGHTVSGGGELTMGLEPSEEEPPK
SPRAPSEGAGSDVFDGDLGMGAAKGLQSLPPQDPSPLQRYSEDPTAPLAPETDGYVAPLT
CSPQPEYVNQPEVWPQPPSPLEGPLPPSRPAGATLERPKTLSPKTLSPGKNGVVKDVFAF
GSAVENPEYLVPQGRAAPQPHPPPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPE
YLGLDVPV
NT seq 3807 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctgctcgccctcctgccctccggagtc
gtgggcacccaagtgtgcaccggcacagacatgaagctgcggctcccagccagtcccgag
acccacctggatatgctccgccacctctaccaggcctgtcaagtggtgcagggtaacctg
gagctcacctacctgcctgccaatgctagcctgtccttcctgcaggatatccaggaggtg
cagggctacgtgctcatcgctcacagccaagtgagacaggtcccgctgcagaggctccga
atcgtgcggggcacccagctctttgaggaccactatgccctggccgtgctggacaatgga
gatccgcccgaggggggcccctctgtggcaggggctgccccagaagggctgcgggagctg
cagcttcgaagcctcacagagatcctgaagggcggggtcttgattcagcggaacccacag
ctctgccaccaggacacgatcctgtggaaggacatcttccacaagaacaaccagctggcc
ctcacgctgatagacaccaaccgctctcgggcctgccagccctgttctccagcttgtaaa
gacccccactgctggggagcaagttccggggactgtcagagcttgacgcgaaccgtctgt
gctggcggctgtgcccgatgcaagggcccgaaacccacggactgctgccacgagcagtgt
gcggctggctgcacgggccccaagcactcggactgcctggcctgccttcacttcaaccac
agtggcatctgtgagctgcactgtccagctctggtcacctacaacacagacaccttcgaa
tccatgcccaaccctgagggccggtacaccttcggagccagctgtgtgaccgcctgtccc
tacaattacctgtcaacggatgtgggatcctgcaccctggtctgtcccctgaacaaccaa
gaggtgaccgctgaggacggaacgcagcggtgtgagaaatgcagcaagccctgtgcccga
gtgtgctatggcctgggcatggagcacctgcgggaggtgagggcggtcaccagcgccaac
atccaagagtttgctggctgcaagaagatctttgggagcctggcatttctgccagaaagc
tttgagggagacccagcctccaacactgcccccctccagcctgagcagctcagagtgttt
gaggctctggaggagatcacaggttacctgtacatctcagcatggccagacagcctgcct
gacctcagtgtcttccagaacctgcgagtcatccggggacgagttctgcatgacggcgcc
tactcactgaccctgcgagggctgggcatcagctcgctggggctgcgctcgctgcgggaa
ctgggtagtgggctggccctcatccaccgcaacgcccacctgtgcttcatacacacggtg
ccctgggaccagctcttccggaacccgcaccaggccctgctccatagcgccaaccggcca
gaggccgagtgtgtgggcgagggcctggcctgctacccgctgtgtgcccatgggcactgc
tggggtccggggcccacccagtgcgtcaactgcagccaattccttcggggccaggagtgc
gtggaggaatgccgagtactgcaggggctaccccgggagtatgtgaaggacaggtactgt
ctcccgtgccactccgagtgtcggccgcagaacggctcagtgacctgctttgggtcggaa
gctgaccagtgtgtggcctgcgcccactacaaggacactcccttctgcgtgtctcgctgc
cccagtggcgtgaaacctgacctctccttcatgcccatttggaagttcgccgatgaggag
ggcacgtgccagccgtgccccatcaactgcacccactcctgtgcggatctggacgagagg
ggctgccctgccgagcagagagccagccctgtgacgtccattattgcggctgtggtgggc
attctgctggccgtgcttgtggggctggtcctcggcatcctaatcaagcgaaggcggcag
aagatccgcaagtacacgatgcggaggctgctgcaggaaaccgagctggtggagccgctg
acgcctagcggagccatgcccaaccaggctcagatgcggatcctgaaagagacagaactg
aggaaggtgaaagtgcttggatccggagcctttggcaccgtctacaagggcatctggatc
cctgatggggaaaatgtgaagatcccagtggccattaaagtgttgagggaaaacacatct
cccaaagccaacaaagaaatcttggacgaagcatatgtgatggctggcgtgggctcccca
tatgtgtcccgccttctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcttagaccacgtccgagagcaccgtgggcgcctgggctcccag
gacctgctgaactggtgtgtgcagatcgctaaggggatgagctacttggaggacgttcgg
ctggtgcacagggacctggctgcccggaacgtgctggtcaagagtcctaaccatgtcaag
ataacagactttgggctggctcggttgctggacattgacgagaccgagtaccatgcagat
gggggcaaggtgcccatcaagtggatggcgctggagtccattctccgccggcggttcacc
caccagagtgacgtgtggagctatggtgtgactgtgtgggaactgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctgctggaaaagggggaacgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
atagactctgaatgtcgaccacggttccgggagttggtggccgaattctcccgcatggcc
agggacccccagcgcttcgtggtcatccagaatgaagacttgggccccgccagtccactg
gacagcaccttctaccgctcgctgctggaagatgatgacatgggggacctggtggatgct
gaggagtacctggtgccccagcaggggttcttctgccccgaccctgccccaggtgctggg
ggcccggcccaccgcaggcaccgcagctcatccacgagggtcagtgcgctcggtcacacc
gtgagtggcggtggtgagctgacaatgggactggagccctccgaggaggagcccccaaag
tctccacgggcaccctcagagggggctggctctgacgtgtttgatggcgacttgggaatg
ggggcagccaaggggctgcagagtcttcccccacaggaccccagccctctacagcggtac
agcgaggaccctactgcacccctggccccagagactgatggctatgttgcccccctgacc
tgcagcccccagcctgaatacgtgaaccagccggaggtttggccgcagcccccctcgccc
ctggaaggccctctgcctccttctcgacctgccggtgccactctggaaaggcccaagact
ctgtcccccaagactctctcccctggcaagaatggggttgtcaaagacgtttttgccttt
gggagtgctgtggagaaccctgagtacttggtaccccagggcagggctgcccctcagccc
caccctcctccagccttcagtccagcctttgacaacctctattactgggaccaggaccca
tcagagcggggctctccacccagcacctttgaagggacccctacagcagagaatcctgag
tacctgggcctggatgtgccagtgtga

DBGET integrated database retrieval system