KEGG   Enhydra lutris kenyoni (northern sea otter): 111151537
Entry
111151537         CDS       T05871                                 

Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00220  Arginine biosynthesis
elk00330  Arginine and proline metabolism
elk01100  Metabolic pathways
elk04020  Calcium signaling pathway
elk04066  HIF-1 signaling pathway
elk04146  Peroxisome
elk04371  Apelin signaling pathway
elk04926  Relaxin signaling pathway
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05022  Pathways of neurodegeneration - multiple diseases
elk05133  Pertussis
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05200  Pathways in cancer
elk05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111151537
   00330 Arginine and proline metabolism
    111151537
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111151537
   04066 HIF-1 signaling pathway
    111151537
   04020 Calcium signaling pathway
    111151537
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111151537
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111151537
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111151537
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111151537
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111151537
   05014 Amyotrophic lateral sclerosis
    111151537
  09171 Infectious disease: bacterial
   05133 Pertussis
    111151537
   05152 Tuberculosis
    111151537
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111151537
   05145 Toxoplasmosis
    111151537
   05140 Leishmaniasis
    111151537
   05142 Chagas disease
    111151537
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     111151537
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 Carb_kinase
Other DBs
NCBI-GeneID: 111151537
NCBI-ProteinID: XP_022365306
UniProt: A0A2Y9JWV2
LinkDB
Position
Unknown
AA seq 1157 aa
MACPWQFLFKAKSYRFNLAEETDINNNVGKASRAPSSLVTQDDPKCHSLGKHRNESPQSL
TGTVKTSPETLVKLDGPPSACPRHVRIKNWGSGMTFQDTLHHKAKGELACKSKSCLGAIM
NPKSLTRGPRDKPTPPDELLPQAIEFVNQYYDSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFAAKQAWRNAPRCIGRIQWSNLQVFDARSCSTAKEMFEHICRHLRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTILGDPASVEFTQLCINLGWEPKYG
RFDVVPLVLQADGRDPEFFEIPPDLVLEVPMEHPRYEWFRELQLKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDIQRYNILEEVGRRMGLETHKLASLWKDRAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQSEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHAWQDEKKRPRRRKIPFKVLVKAVLFASMLIRKTMVSRVRAT
ILFATETGKSETLAQDLGALFSCAFNPKVLCMDEYRLSHLEEEKLLLVVTSTFGNGDSPS
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLVLTGEGD
ELSGQEEAFCSWAVQTFKAACEAFDVRGKHGIQIPKRYTCSMTWDPQHYRLVQDLQPLDL
NKALSSMHAKNVFTLRLKSQRNLQSPQSSRTTLLVELSCEDSHGLSYLPGEHLGICPGNQ
PALVQGILDRVVDSPAPHQPVHLETLSESGSYWLRDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAERQRLEILCQPSEYNKWKFTNSPTFLEVLQEFPSLRVSAGFLLSQL
PILKPRYYSISSSRDCTPMEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSADNFQLPEDPSHPCILIGPGTGIAPFRGFWQQRLHDTKHKGLQAGRMTLVFGCCRPD
EDHLYREEMLEMAQNGVLHEVHTAYSRLPGQPKVYVQDLLRQQLASEVLRVLHEEHGHLY
VCGDVRMARDVARTLKGLVAAELSLSEKQVEDYFFQLKSQKRYHEDIFGAVFTYEVKKDG
AARQPSDPRVPAAHGRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaggccaaatcctaccggttcaacttggccgag
gaaacagacatcaacaacaatgtggggaaagccagccgggccccctccagtctagtgaca
caggatgaccccaagtgtcacagcctcggcaagcaccggaatgagtccccccagtccctc
acagggacagtaaagacgtctccagaaaccctggtcaagctggatgggcccccatcggcc
tgccctcggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacactc
caccacaaggccaaaggggagcttgcatgcaagtccaagtcttgtctgggagccatcatg
aaccccaaaagtttaaccagaggacccagggacaagcctactcccccagatgagcttcta
cctcaagctattgaatttgtcaaccaatattatgactccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctatcag
ctgacgggggatgagctcatcttcgcggccaagcaggcctggcgcaacgctccccgctgc
atcgggagaatccagtggtccaacctgcaggtcttcgacgcccggagctgttccactgcc
aaggaaatgttcgagcacatctgcagacacctgcgttatgcaaccaacaatggcaacatc
aggtcggccatcaccgtgttcccgcagcggagcgatgggaagcatgacttccgggtctgg
aacgctcagctcatccggtatgcgggctaccagatgcctgacggcaccatcctgggggac
cccgccagcgtggagttcacccagctgtgcatcaaccttggctgggagcccaagtacggc
cgcttcgacgtggtgcctctggtgctgcaggcggacggccgtgaccctgagttctttgaa
atcccgcccgaccttgtgctcgaggtgcccatggaacatcccaggtatgagtggttccgt
gagctgcagctaaagtggtatgccttgcctgcagtggccaacatgctccttgaagtgggt
ggccttgagttcccagggtgccccttcaatggctggtacatgggcacggagatcggggtc
cgggacttctgtgacattcagcgctacaacattctagaggaagtgggcagaaggatgggc
ctggaaacacacaagctggcctcactctggaaagaccgggctgtcattgagatcaatgtc
gctgtgctccacagtttccagaagcagaatgtgaccatcatggaccaccactcagctgca
gagtccttcatgaagtacatgcagagcgagtaccgctcccgagggggctgcccagctgac
tggatttggctggttcccccgatttctgggagcatcactcctgtgttccaccaggagatg
ttaaactatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgcc
tggcaagatgagaagaagagaccccggagaagaaagattccattcaaagtcttggttaag
gctgtgctcttcgcctccatgctgattcgcaagaccatggtgtcccgagtcagagccacc
atcctctttgccacagagacaggaaagtcggaaacactggcccaggacctgggggccttg
ttcagctgtgccttcaaccccaaggttctgtgcatggacgagtacagactgagccatctg
gaggaggagaagctgctgctggtggtgaccagcacgtttgggaatggagactcccccagc
aacggagagaaactgaaaaaatctctcttcatgctgaaagagcttaccaacaagttcagg
tatgctgtgttcggccttggctccagcatgtacccgcagttctgtgcctttgctcatgac
atcgaccagaagttgtcccatctgggggcctcccagctcgtccttacaggggaaggggat
gagctcagtggacaggaggaagccttctgtagctgggctgtgcaaaccttcaaggcagcc
tgcgaagcattcgatgtgcgaggcaaacacgggattcagatccctaagcgctacacctgc
agtatgacctgggacccacagcactaccggctcgtgcaggacttgcagcctctggacctc
aacaaagccctcagcagtatgcacgccaagaacgtgttcaccctgcggctcaaatcacag
cggaatctacagagtccccagtccagccgcaccaccctcctggtggagctctcctgtgag
gacagccacgggctgagctacctgcctggagagcaccttgggatttgcccgggcaaccag
ccggccctggtgcaaggcatcttggatcgagtggtagacagccctgcgccccaccagcct
gtgcacctggagaccctcagcgagagcggaagctactggctcagagacaagcggctgccc
ccatgctcactcagccaggccctcacctacttcctggacatcaccacccccccaacccag
ctgctgctccgaaagctggcacagctggccacagaagaagctgagaggcagagactggag
atcctgtgccagccctcagaatacaacaagtggaagttcaccaacagccccacattcctg
gaggtgctgcaggagttcccgtccctgcgggtgtctgctggctttctgctctcccagctc
ccgattctgaaaccccggtactactccatcagctcctccagggactgcacacccatggag
gtccacctcaccgtggctgtgctcacgtaccgcacccgagatggccaaggtcccttgcac
catggtgtctgtagcacgtggctcagcagcctgaagccccaagacccagtaccctgcttc
gtgagaagtgctgacaacttccagctccctgaggacccctcccatccttgcatcctcatc
ggacctggcacaggcatcgccccctttcgtggtttctggcagcagcggctacatgacacc
aagcacaaagggctccaggccggccgcatgaccctggtgttcgggtgctgccgcccagat
gaggaccacctgtatcgagaggagatgttggagatggcccagaatggggtgctgcacgag
gtgcacacagcctattctcgtctgcctggccagcccaaggtctatgttcaagacctcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacgaggagcatggccacctttat
gtctgtggggacgtgcgtatggcccgggatgtggcccgtacgctgaagggcttggtggct
gctgagctgagcctgagtgagaagcaggtggaggactatttcttccagctgaagagccag
aagcgctatcatgaagatatctttggtgctgtgtttacttacgaggtgaaaaaagatggg
gcagcaaggcaacccagtgatcccagagttccagcagcccatgggagaagttga

DBGET integrated database retrieval system