KEGG   Enhydra lutris kenyoni (northern sea otter): 111151694
Entry
111151694         CDS       T05871                                 

Definition
(RefSeq) zinc finger matrin-type protein 3 isoform X1
  KO
K10137  zinc finger, matrin type 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111151694
SSDB
Motif
Pfam: zf-C2H2_jaz zf-met zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 111151694
NCBI-ProteinID: XP_022365544
UniProt: A0A2Y9K1E4
LinkDB
Position
Unknown
AA seq 289 aa
MILLQHASLPLPKRPSSSPPMSVAARSAGTLQLPPQKPFGQEASLPLAGEVELPKGGEQD
SALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPV
ATPAVPVPPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QSNSFSESSEAGQRRTRKEGNEYKMMPNRRNMYTVQNNSAGPYFNPRSRQRIPRDLAMCV
TPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
NT seq 870 nt   +upstreamnt  +downstreamnt
atgatcctcttgcaacacgccagccttcctctgcctaagcggccctcatcctctcctcct
atgtcagtggctgcccggtctgcaggaactttgcagcttccgccacagaagccttttggg
caggaggcttccttgcctctggctggggaagtagagttaccgaagggaggggagcaagac
tctgccctggaggagctatgtaagcccctgtactgcaaactctgcaatgtcaccttgaac
tctgcgcagcaagcccaggctcattatcagggtaaaaatcatggtaagaaactccgaaat
tactatgcagccaacagctgtcctcctcctgccagaatgagcaacgtggtggaacctgtg
gctactccagctgttcccgtccctccgcagatgggctcctttaagcctggaggcagagtg
atcctggccacggagaatgattactgtaagctttgtgatgcctcctttagttctccggct
gtggctcaggctcactatcaagggaagaatcacgccaagaggctgcggctggcggaagct
cagagtaactcattctcggagtcctcagaggccggtcagcggcggacccggaaagaaggg
aatgagtataagatgatgcctaataggaggaatatgtatacagtacagaataattcagca
ggtccttacttcaatccccgctctcggcagagaattccacgtgatctggccatgtgtgtt
accccgagtggccagttttactgctccatgtgtaatgttggggctggtgaggagatggag
ttccggcagcatttagagagcaagcaacataaaagcaaggtgtctgaacagcggtacaga
aatgagatggagaatctgggatatgtatag

DBGET integrated database retrieval system