KEGG   Enhydra lutris kenyoni (northern sea otter): 111151705
Entry
111151705         CDS       T05871                                 

Definition
(RefSeq) histone acetyltransferase KAT2A isoform X1
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04330  Notch signaling pathway
elk04919  Thyroid hormone signaling pathway
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111151705
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111151705
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111151705
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111151705
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     111151705
Transcription machinery [BR:elk03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     111151705
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    111151705
   HAT complexes
    PCAF complex
     111151705
    STAGA complex
     111151705
    TFTC complex
     111151705
    SAGA complex
     111151705
    SLIK complex
     111151705
    ADA-HAT complex
     111151705
    HAT-A2 complex
     111151705
    ATAC complex
     111151705
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Other DBs
NCBI-GeneID: 111151705
NCBI-ProteinID: XP_022365565
UniProt: A0A2Y9K7T0
LinkDB
Position
Unknown
AA seq 838 aa
MAEPSQASTPAPATQPRPLQSPAPAPTPTPAPSPASAPTPAPTPAPAPAPAAAPAGSTGT
GGPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHIFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSAAVVPSTPLFSPTMGGGSNSSLS
LDSGGAEPMPAGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSL
LSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYI
ARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLK
EYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRI
PYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPL
GKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKAEAPDYYEVIRFPIDLKTMT
ERLRSRYYVTRKLFVADLQRVIANCREYTPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2517 nt   +upstreamnt  +downstreamnt
atggcggaaccttcccaggcttcgaccccggccccggccactcagccccgtccccttcag
tctccagcccctgccccaactccgactcctgcccctagtccggcttcagccccgactccg
gctcccactccggcaccagcccccgccccagctgcagcgccagccggcagcacagggact
gggggtcctggggtaggaagtggggggacggggagcggaggggatccggctcgacctggt
ctgagccagcagcagcgcgccagccagaggaaggcgcaagtccgggggctgccgcgcgcc
aagaagctcgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgcaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggacctgcagcagccagct
gccaacctgagcgagctgtgccgcagttgtgagcaccccttggctgaccatgtgtcccac
ctggagaatgtgtcagaggatgagatcaaccggttgctgggtatggtggtagacgtggag
aatctgtttatgtctgttcacaaagaggaggacacagacactaagcaggtctatttctac
ctcttcaagctcctgcggaaatgcatcctgcagatgacacggccagtggtggagggctcc
ctgggcagtcccccctttgagaagcctaatattgagcagggtgtgctgaatttcgtgcag
tacaagttcagtcacctggctcctcgggagcggcagacgatgtttgagctctcaaagatg
ttcctgctctgccttaactactggaagcttgagacgccagcccaatttcggcagcggtct
caggccgaggatgtggctacctacaaggtcaattataccaggtggctctgctactgccat
gtgccccagagctgcgacagcctcccccgctacgagaccactcacatcttcgggcgaagc
ctcctccgctccatcttcacggtgacccggcgacagttgctggagaaattccgggtggag
aaggacaagctggtgcctgagaagaggaccctcatcctcacccacttcccaaaattcctg
tccatgctggaggaggagatctatggggcaaactctccgatctgggagtctggcttcacc
atgccgccctcagaggggacgcagctggtgcccaggccggctacagtcagcgcagcagtt
gtccccagcacccccctcttcagccccaccatgggtgggggcagcaacagctccttgagc
ctggattccggaggggctgagcccatgccagcaggtgagaagaggaagctcccagagaac
ctgaccctggaggatgccaagcggctccgtgtcatgggcgacatccccatggagctggtc
aacgaggtcatgctcaccatcaccgaccccgccgccatgctggggcctgagacgagcctg
ctgtcggccaacgcagcccgggacgagacagcccgcctggaggagcgccgcggcatcatc
gagttccatgtcatcggcaactcgctgacacccaaggccaaccggcgggtgttgctctgg
cttgtggggctgcagaacgtcttctcccatcagctgccacgcatgcccaaggagtatatc
gcccgccttgtctttgacccgaagcacaagactctggccttgatcaaggatgggcgggtc
atcggtgggatctgcttccgcatgtttcccactcagggcttcacagagattgtcttctgc
gccgtcacctcgaatgagcaggtcaagggctatgggactcacctgatgaaccacctgaag
gagtatcacatcaaacacaacatcctctacttcctcacctatgctgacgagtatgccatc
ggctacttcaaaaagcagggcttctccaaggacatcaaagtgcccaagagccgctacctg
ggctacattaaggactatgagggtgcaacattgatggagtgtgagctgaatccccggatc
ccctacacggagctgtcccacatcatcaaaaagcagaaggagatcatcaagaagctgatt
gagcgcaaacaggcccagatccgaaaggtgtaccccgggctcagctgcttcaaggaggga
gtgaggcagatccccgtggagagtgtccccggcattcgagagacgggctggaagccactg
gggaaggagaaggggaaggagctgaaggatccagaccagctctatacgaccctcaaaaac
ttgctggcccagatcaagtcacaccccagtgcctggcccttcatggagcctgtgaagaag
gcggaagcccctgactactacgaggtcatccgcttccctattgacctgaagaccatgact
gagcgactgcgcagccgctactacgtcacccgcaagctcttcgtggccgacctgcagcgg
gtcatcgccaactgccgcgagtacacccccccggacagcgagtactgccgctgcgccagc
gccctggagaagttcttctacttcaagctcaaggagggggggctcattgacaagtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155064
Entry
111155064         CDS       T05871                                 

Definition
(RefSeq) histone acetyltransferase KAT2B
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04330  Notch signaling pathway
elk04919  Thyroid hormone signaling pathway
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111155064
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111155064
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111155064
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111155064
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     111155064
Transcription machinery [BR:elk03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     111155064
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    111155064
   HAT complexes
    PCAF complex
     111155064
    STAGA complex
     111155064
    TFTC complex
     111155064
    SAGA complex
     111155064
    SLIK complex
     111155064
    ADA-HAT complex
     111155064
    HAT-A2 complex
     111155064
    ATAC complex
     111155064
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Other DBs
NCBI-GeneID: 111155064
NCBI-ProteinID: XP_022370804
UniProt: A0A2Y9KH56
LinkDB
Position
Unknown
AA seq 832 aa
MSEAGGAGPGGGGAGVGAGAGLGALPPQPPVPPPAPPQGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVISPPPVAGTISYNSNSSSLEQPNGGSTSPSCKGSSG
LEANSGEKRKMNDSHALEEAKKPRVMGDIPMELIDEVMSTITDPAAMLGPETNLLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPKDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgtccgaggctggcggggccgggccgggcggcggcggggcaggggtcggggcaggggcc
gggctcggggcgctgcccccgcagccccccgtgccgccgcccgcgccgccgcagggctcc
ccgtgcgccgcagccgccgggggctcgggcgcctgcggaccggcgacggcagtggcggcg
gcgggcacggccgaaggaccaggaggcggcggctcggcccggatcgcggtgaagaaggcg
caactgcgctcggctccgcgggccaagaaactggagaaactcggagtgtactccgcctgc
aaggccgaggagtcttgtaaatgtaatggctggaaaaatcccaacccttctcctactccc
cccagagctgacctgcagcaaatcattgtcagtctaacagaatcctgccggagttgtagc
catgcactagctgctcatgtttcccacctggaaaatgtgtccgaggaagaaatgaacaga
ctcctgggaatagtgttggatgtggaatatctctttacctgtgtccacaaggaagaagat
gcagataccaaacaagtttatttctatctatttaagctcttgagaaagtctattttacaa
agaggaaaacctgtggttgaaggctctttggagaagaaacccccatttgaaaaacctagt
attgaacagggtgtgaataactttgtacagtacaaatttagtcacctgccatccaaagaa
aggcaaacaattgttgagttggcaaaaatgttcctaaaccgcatcaactattggcacctg
gaggcaccatctcaacgaagactgcgatctcccaatgatgatatttctggatacaaagag
aattacacaaggtggctgtgttactgcaacgtgccccagttctgcgacagtctacctcgg
tatgaaaccacccaggtgtttgggagaacactgctgcgctcagtcttcacagtcatgaga
cgacaactcctggaacaagcgagacaggagaaagacaaactgccacttgaaaaacgaact
ctaatccttacccattttccaaagttcctgtccatgttagaagaagaagtttatagtcaa
aactctcctatctgggatcaggattttctctcagcctcttccagaaccagccagctagga
atccaaacagtcatcagtccacctcctgtagctgggaccatttcatataattcaaactca
tcttctcttgagcaacctaatggagggagcaccagtccttcctgcaaaggctcttctggg
cttgaggcaaactcaggagaaaagaggaaaatgaatgactctcatgccttggaggaagcc
aagaagccccgagttatgggggatattccaatggaattaatcgacgaggtcatgtctacc
atcacagaccctgcagcaatgcttggaccagagaccaatttactgtcagcacattcagcc
agggacgaggcagcaaggctggaagagcgcaggggtgtgattgaatttcatgtggtcggc
aattccctgaaccagaaacccaacaagaagattctaatgtggctggtcggtctccagaac
gtgttctcacaccagctgccccggatgccaaaagagtacatcacacggcttgtctttgac
ccgaaacacaaaacccttgccctaattaaagatggccgtgttattggtggtatctgtttc
cgcatgttcccatcccaaggattcacagagattgttttctgtgctgtaacctcaaatgag
caagtcaagggctatggaacacacctgatgaatcacttgaaagaatatcatataaaacat
gatatcctgaacttcctcacatatgcagatgaatatgccattggttacttcaagaaacag
ggtttctccaaagaaattaaaatacctaaaaccaaatatgttggctacatcaaggattat
gagggggccactttaatgggatgtgagctaaatccacggatcccatacacagaattttct
gtcatcattaagaagcaaaaggagatcattaaaaagctgatagaaagaaaacaagcccag
attcgaaaagtataccctggactttcatgttttaaagatggagttcggcagattccaata
gaaagcattcccggaattagagagacaggctggaagccgagtggaaaagagaaaagtaaa
gagcccaaagaccctgaccagctttacagcacgctcaagagcatcctgcagcaggtgaag
agccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctccgggatat
tatgaagttataaggttccccatggatctgaaaaccatgagcgaacgcctcaagaatagg
tactacgtgtctaagaaattattcatggcagacttacagcgagtctttaccaattgcaaa
gagtacaacccccctgagagtgaatactacaaatgtgccaatatcctggagaaattcttc
ttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system