KEGG   Enhydra lutris kenyoni (northern sea otter): 111152183
Entry
111152183         CDS       T05871                                 

Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04015  Rap1 signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04261  Adrenergic signaling in cardiomyocytes
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04714  Thermogenesis
elk04722  Neurotrophin signaling pathway
elk04723  Retrograde endocannabinoid signaling
elk04728  Dopaminergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04912  GnRH signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05205  Proteoglycans in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111152183
   04015 Rap1 signaling pathway
    111152183
   04370 VEGF signaling pathway
    111152183
   04668 TNF signaling pathway
    111152183
   04068 FoxO signaling pathway
    111152183
   04071 Sphingolipid signaling pathway
    111152183
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111152183
   04218 Cellular senescence
    111152183
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111152183
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111152183
   04613 Neutrophil extracellular trap formation
    111152183
   04620 Toll-like receptor signaling pathway
    111152183
   04621 NOD-like receptor signaling pathway
    111152183
   04622 RIG-I-like receptor signaling pathway
    111152183
   04625 C-type lectin receptor signaling pathway
    111152183
   04660 T cell receptor signaling pathway
    111152183
   04658 Th1 and Th2 cell differentiation
    111152183
   04659 Th17 cell differentiation
    111152183
   04657 IL-17 signaling pathway
    111152183
   04664 Fc epsilon RI signaling pathway
    111152183
   04670 Leukocyte transendothelial migration
    111152183
  09152 Endocrine system
   04912 GnRH signaling pathway
    111152183
   04914 Progesterone-mediated oocyte maturation
    111152183
   04917 Prolactin signaling pathway
    111152183
   04926 Relaxin signaling pathway
    111152183
   04935 Growth hormone synthesis, secretion and action
    111152183
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111152183
  09156 Nervous system
   04728 Dopaminergic synapse
    111152183
   04723 Retrograde endocannabinoid signaling
    111152183
   04722 Neurotrophin signaling pathway
    111152183
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111152183
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111152183
  09159 Environmental adaptation
   04714 Thermogenesis
    111152183
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111152183
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111152183
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111152183
   05020 Prion disease
    111152183
   05022 Pathways of neurodegeneration - multiple diseases
    111152183
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111152183
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111152183
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111152183
   05135 Yersinia infection
    111152183
   05133 Pertussis
    111152183
   05152 Tuberculosis
    111152183
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111152183
   05161 Hepatitis B
    111152183
   05171 Coronavirus disease - COVID-19
    111152183
   05163 Human cytomegalovirus infection
    111152183
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152183
   05169 Epstein-Barr virus infection
    111152183
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111152183
   05140 Leishmaniasis
    111152183
   05142 Chagas disease
    111152183
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111152183
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111152183
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111152183
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111152183
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 111152183
NCBI-ProteinID: XP_022366263
UniProt: A0A2Y9JZ05
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaatctctccccggtgggctctggtgcctatggctccgtgtgtgct
gcttttgacacaaaaaccgggttacgtgtggcagtgaagaagctctccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgatcggtctgctggatgtttttacacctgcaaggtctctggaggaattcaat
gatgtatatctggtgacccatctcatgggagcagatctgaacaacattgtgaaatgtcag
aagcttacggatgaccatgttcagttcctcatctaccagattctccgaggtctcaagtat
atacattcagcagacataattcacagggacctaaaacctagtaatctagctgtgaacgaa
gactgtgagctgaagatcttggattttggactggcccgacacacagatgatgaaatgaca
ggctatgtggccaccaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgatcttttgaagaaaatctcctcagagtctgcaaggaactacattcag
tctttgacccagatgccgaaaatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacttgctggagaagatgcttgtattggactcagacaagagaattacggcagcc
caagcccttgcacacgcctactttgctcagtaccatgatcctgatgatgaaccagtagct
gacccttatgatcaatcctttgaaagcagggacctccttatagatgaatggaaaagcctg
acctacgatgaagtcatcagctttgtgccgccaccccttgaccaagaagagatggaatcc
tga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152267
Entry
111152267         CDS       T05871                                 

Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04015  Rap1 signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04261  Adrenergic signaling in cardiomyocytes
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04714  Thermogenesis
elk04722  Neurotrophin signaling pathway
elk04723  Retrograde endocannabinoid signaling
elk04728  Dopaminergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04912  GnRH signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05205  Proteoglycans in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111152267
   04015 Rap1 signaling pathway
    111152267
   04370 VEGF signaling pathway
    111152267
   04668 TNF signaling pathway
    111152267
   04068 FoxO signaling pathway
    111152267
   04071 Sphingolipid signaling pathway
    111152267
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111152267
   04218 Cellular senescence
    111152267
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111152267
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111152267
   04613 Neutrophil extracellular trap formation
    111152267
   04620 Toll-like receptor signaling pathway
    111152267
   04621 NOD-like receptor signaling pathway
    111152267
   04622 RIG-I-like receptor signaling pathway
    111152267
   04625 C-type lectin receptor signaling pathway
    111152267
   04660 T cell receptor signaling pathway
    111152267
   04658 Th1 and Th2 cell differentiation
    111152267
   04659 Th17 cell differentiation
    111152267
   04657 IL-17 signaling pathway
    111152267
   04664 Fc epsilon RI signaling pathway
    111152267
   04670 Leukocyte transendothelial migration
    111152267
  09152 Endocrine system
   04912 GnRH signaling pathway
    111152267
   04914 Progesterone-mediated oocyte maturation
    111152267
   04917 Prolactin signaling pathway
    111152267
   04926 Relaxin signaling pathway
    111152267
   04935 Growth hormone synthesis, secretion and action
    111152267
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111152267
  09156 Nervous system
   04728 Dopaminergic synapse
    111152267
   04723 Retrograde endocannabinoid signaling
    111152267
   04722 Neurotrophin signaling pathway
    111152267
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111152267
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111152267
  09159 Environmental adaptation
   04714 Thermogenesis
    111152267
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111152267
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111152267
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111152267
   05020 Prion disease
    111152267
   05022 Pathways of neurodegeneration - multiple diseases
    111152267
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111152267
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111152267
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111152267
   05135 Yersinia infection
    111152267
   05133 Pertussis
    111152267
   05152 Tuberculosis
    111152267
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111152267
   05161 Hepatitis B
    111152267
   05171 Coronavirus disease - COVID-19
    111152267
   05163 Human cytomegalovirus infection
    111152267
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152267
   05169 Epstein-Barr virus infection
    111152267
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111152267
   05140 Leishmaniasis
    111152267
   05142 Chagas disease
    111152267
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111152267
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111152267
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111152267
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111152267
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kdo Kinase-like DUF4023 DUF3231
Other DBs
NCBI-GeneID: 111152267
NCBI-ProteinID: XP_022366428
UniProt: A0A2Y9JZF2
LinkDB
Position
Unknown
AA seq 366 aa
MSFTRKKGFYKQDVNKTAWELPKTYLSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELRLLKHMQHENVIGLLDVFTSASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLSQILKVTG
VPGAEFVQKLNDKAAKSYIQALPQSPKKDFSQLFPRASPQAIDLLEKILELDVDKRLTAS
QALAHPFFEPFRDPEEETEAPQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARRDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcttcacgcggaagaagggcttctacaagcaggacgtcaacaagactgcctgggag
ctgcccaagacctacttgtccccgacgcacgtaggcagcggggcgtatggcgccgtgtgc
tctgccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaagcgggcctaccgagagctgcggctgctgaagcacatgcag
catgagaacgtcatcgggctcctggatgtcttcacctcagcctcctccctgcgcagtttc
catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtacctggtgtatcaaatgctcaagggtctcaagtat
atccactcagctggggtcgtgcacagggacctgaagccgggcaacctggccgtgaatgag
gattgcgagctgaagatcttggattttgggctggcccggcatgcggacgccgagatgacg
ggctacgtggtgacccgctggtaccgggcccctgaggtgatcctcagctggatgcactac
aatcagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacggggaaa
actctgttcaaggggaaagattacctggaccagctgtcccagatcctaaaagtgaccggg
gtgccaggggcagagtttgtgcagaagctgaacgacaaagcagccaaatcctacatccag
gccctgccacagagtcccaagaaggatttctctcagctcttcccacgtgccagtccccag
gccatagacctgctggagaagattctggagctggatgtggacaagcgcctgacggcctcg
caggcccttgcccaccccttctttgagcccttccgagaccccgaggaggagacagaggcc
ccgcagccatttgatgattccttagaacatgagaaactcacagtggatgaatggaagcag
cacatctacaaggagatcgtgaacttcagtcccattgcccggagggactcacggcgccgc
agcggcatgaagctgcagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157625
Entry
111157625         CDS       T05871                                 

Definition
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04015  Rap1 signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04261  Adrenergic signaling in cardiomyocytes
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04714  Thermogenesis
elk04722  Neurotrophin signaling pathway
elk04723  Retrograde endocannabinoid signaling
elk04728  Dopaminergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04912  GnRH signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05205  Proteoglycans in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111157625
   04015 Rap1 signaling pathway
    111157625
   04370 VEGF signaling pathway
    111157625
   04668 TNF signaling pathway
    111157625
   04068 FoxO signaling pathway
    111157625
   04071 Sphingolipid signaling pathway
    111157625
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111157625
   04218 Cellular senescence
    111157625
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111157625
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111157625
   04613 Neutrophil extracellular trap formation
    111157625
   04620 Toll-like receptor signaling pathway
    111157625
   04621 NOD-like receptor signaling pathway
    111157625
   04622 RIG-I-like receptor signaling pathway
    111157625
   04625 C-type lectin receptor signaling pathway
    111157625
   04660 T cell receptor signaling pathway
    111157625
   04658 Th1 and Th2 cell differentiation
    111157625
   04659 Th17 cell differentiation
    111157625
   04657 IL-17 signaling pathway
    111157625
   04664 Fc epsilon RI signaling pathway
    111157625
   04670 Leukocyte transendothelial migration
    111157625
  09152 Endocrine system
   04912 GnRH signaling pathway
    111157625
   04914 Progesterone-mediated oocyte maturation
    111157625
   04917 Prolactin signaling pathway
    111157625
   04926 Relaxin signaling pathway
    111157625
   04935 Growth hormone synthesis, secretion and action
    111157625
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111157625
  09156 Nervous system
   04728 Dopaminergic synapse
    111157625
   04723 Retrograde endocannabinoid signaling
    111157625
   04722 Neurotrophin signaling pathway
    111157625
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111157625
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111157625
  09159 Environmental adaptation
   04714 Thermogenesis
    111157625
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111157625
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111157625
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111157625
   05020 Prion disease
    111157625
   05022 Pathways of neurodegeneration - multiple diseases
    111157625
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111157625
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111157625
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111157625
   05135 Yersinia infection
    111157625
   05133 Pertussis
    111157625
   05152 Tuberculosis
    111157625
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111157625
   05161 Hepatitis B
    111157625
   05171 Coronavirus disease - COVID-19
    111157625
   05163 Human cytomegalovirus infection
    111157625
   05167 Kaposi sarcoma-associated herpesvirus infection
    111157625
   05169 Epstein-Barr virus infection
    111157625
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111157625
   05140 Leishmaniasis
    111157625
   05142 Chagas disease
    111157625
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111157625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111157625
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111157625
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111157625
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 111157625
NCBI-ProteinID: XP_022374908
UniProt: A0A2Y9KP74
LinkDB
Position
Unknown
AA seq 364 aa
MSGPRAGFYRLELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPAEPPQSPSSL
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggcccgcgcgcaggcttctaccggctggagctcaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggttgcgccccgtgggctccggcgcctacggctcggtctgctcg
gcctatgacgcgcggctacggcagaaggtggcggtaaagaagctgtcgcgacccttccag
tcgctgatccacgcgcggagaacgtaccgcgagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggctgctggacgtgttcacgccggccacctccattgaggacttcagc
gaagtgtacctggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgtccagttcctggtttatcagctgctgcgcgggctgaagtac
atccactcggcagggatcattcaccgggacctgaagcccagcaacgtggcggtgaacgag
gactgcgagctgcggatcctggacttcgggctagcccgccaggctgatgaagagatgacc
ggctatgtggccactcgctggtaccgggcccccgagatcatgctgaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctccagggaaag
gccctcttcccaggaagtgactacatcgaccagctgaagcgaatcatggaagtggtgggc
acacccagccctgaggttctagcaaagatttcctcagaacacgcccggacctacatccag
tccctgcctcccatgccccagaaggacctcaggagcatcttccatggggccaaccccctg
gctgtggacctcctgggaaggatgctggtgctcgacagcgaccagagggtcagtgcggcg
gaggccctggcccatgcctacttcagccagtaccatgaccccgatgatgagcctgaggct
gagccctacgatgagagtgttgaggccaaggagcgcaccgtggaggagtggaaggagctc
acctaccaggaagtcctcagcttcaagcccgcagagccaccgcagtctcccagcagcctg
gagattgagcagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157628
Entry
111157628         CDS       T05871                                 

Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04015  Rap1 signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04261  Adrenergic signaling in cardiomyocytes
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04714  Thermogenesis
elk04722  Neurotrophin signaling pathway
elk04723  Retrograde endocannabinoid signaling
elk04728  Dopaminergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04912  GnRH signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05205  Proteoglycans in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111157628
   04015 Rap1 signaling pathway
    111157628
   04370 VEGF signaling pathway
    111157628
   04668 TNF signaling pathway
    111157628
   04068 FoxO signaling pathway
    111157628
   04071 Sphingolipid signaling pathway
    111157628
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111157628
   04218 Cellular senescence
    111157628
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111157628
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111157628
   04613 Neutrophil extracellular trap formation
    111157628
   04620 Toll-like receptor signaling pathway
    111157628
   04621 NOD-like receptor signaling pathway
    111157628
   04622 RIG-I-like receptor signaling pathway
    111157628
   04625 C-type lectin receptor signaling pathway
    111157628
   04660 T cell receptor signaling pathway
    111157628
   04658 Th1 and Th2 cell differentiation
    111157628
   04659 Th17 cell differentiation
    111157628
   04657 IL-17 signaling pathway
    111157628
   04664 Fc epsilon RI signaling pathway
    111157628
   04670 Leukocyte transendothelial migration
    111157628
  09152 Endocrine system
   04912 GnRH signaling pathway
    111157628
   04914 Progesterone-mediated oocyte maturation
    111157628
   04917 Prolactin signaling pathway
    111157628
   04926 Relaxin signaling pathway
    111157628
   04935 Growth hormone synthesis, secretion and action
    111157628
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111157628
  09156 Nervous system
   04728 Dopaminergic synapse
    111157628
   04723 Retrograde endocannabinoid signaling
    111157628
   04722 Neurotrophin signaling pathway
    111157628
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111157628
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111157628
  09159 Environmental adaptation
   04714 Thermogenesis
    111157628
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111157628
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111157628
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111157628
   05020 Prion disease
    111157628
   05022 Pathways of neurodegeneration - multiple diseases
    111157628
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111157628
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111157628
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111157628
   05135 Yersinia infection
    111157628
   05133 Pertussis
    111157628
   05152 Tuberculosis
    111157628
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111157628
   05161 Hepatitis B
    111157628
   05171 Coronavirus disease - COVID-19
    111157628
   05163 Human cytomegalovirus infection
    111157628
   05167 Kaposi sarcoma-associated herpesvirus infection
    111157628
   05169 Epstein-Barr virus infection
    111157628
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111157628
   05140 Leishmaniasis
    111157628
   05142 Chagas disease
    111157628
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111157628
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111157628
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111157628
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111157628
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 111157628
NCBI-ProteinID: XP_022374918
UniProt: A0A2Y9KUH7
LinkDB
Position
Unknown
AA seq 486 aa
MSSPPPARRGFYRQEVTRTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELYAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRVGPRGGGRSPWPIGEGGAWLPGAPIAGA
QLLGARDQCPSWKGCWVGLTGGGERGLFSAYAPMGGAARPPLSCPQDLKPSNLAVNEDCE
LKILDFGLARQADSEMTGYVVTRWYRAPEVILNWTRYTQTGEKLPRDAEPPWRQPPGPHP
PASNSSWEVRGRLLPGKAAELGWEPVDIWSAGCIMAEMITGKTLFKGSDHLDQLKEIMKV
TGTPPAEFVQRLQSADAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAERRVT
AAEALTHPYFESLQDTEDEPTAQKYDESFDDMDHTLDEWKRVTYKEVLSFKPPRQLGTKV
SKETAL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgagctcgccgccgcccgcccgtaggggcttctaccgccaggaggtgaccaggacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgtgggctcgggcgcctacggcgcg
gtgtgctcggcggtggacagccgcactggcgccaaggtggccatcaagaagctgtaccgg
cccttccagtccgagctgtacgccaagcgcgcctaccgcgagctgcgtctcctcaagcac
atgcgccacgagaacgtcatcgggctgctggatgtgttcactcctgatgaaaccctggat
gatttcacagacttttacctggtgatgccgttcatggggactgacctgggcaagctcatg
aagcacgagaagctgagtgaggaccgaatccagttcctcgtctaccagatgctgaagggg
ctaaagtatatccatgctgctggcatcatccacagggtaggtcctcgtggtggtgggagg
tccccctggcctataggtgagggaggggcctggctgcctggagcccccatcgcgggggca
cagctgttgggggcgagagaccagtgcccttcttggaagggctgctgggtggggctgacc
ggaggtggggaacgggggctcttctctgcgtatgcccccatgggaggggctgcgcggcca
cctctctcctgcccccaggacctgaagcccagcaatctggcagtgaacgaggactgtgag
ctgaagatcctggacttcggcctggcaaggcaggccgacagcgagatgaccgggtatgtg
gtgacccggtggtaccgggcacccgaggtcatcttgaattggacgcgctacacgcagacg
ggtgagaagctgcccagagacgcagagccgccctggcgccagcctcccgggccacacccc
ccggcttccaattcttcatgggaagtccggggccggctcctccccgggaaggctgctgag
ctgggatgggagcctgtggacatctggtcggcgggctgcatcatggcggagatgatcaca
gggaagacgctgttcaagggcagtgaccacctggaccagctgaaggagatcatgaaggtg
accgggacgcctcctgccgagtttgttcagaggctgcagagtgccgatgcgaagaactac
atgaagggcctccccgagttggagaagaaggattttgcctccatcctgactaatgcaagc
cctctagccgtgaaccttctggagaaaatgctggtgctggatgcagagcggcgggtgact
gcggctgaggcgctgacccacccctacttcgagtcactgcaggacacggaggacgagccc
acggcccagaagtatgatgagtcctttgatgatatggatcacacgctggacgagtggaaa
cgtgtcacatacaaagaagtgctcagcttcaagcctccccggcagctggggaccaaggtc
tccaaggagacggctctgtga

DBGET integrated database retrieval system