KEGG   Enhydra lutris kenyoni (northern sea otter): 111152248
Entry
111152248         CDS       T05871                                 

Definition
(RefSeq) tumor necrosis factor isoform X1
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01523  Antifolate resistance
elk04010  MAPK signaling pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04064  NF-kappa B signaling pathway
elk04071  Sphingolipid signaling pathway
elk04150  mTOR signaling pathway
elk04210  Apoptosis
elk04217  Necroptosis
elk04350  TGF-beta signaling pathway
elk04380  Osteoclast differentiation
elk04612  Antigen processing and presentation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04640  Hematopoietic cell lineage
elk04650  Natural killer cell mediated cytotoxicity
elk04657  IL-17 signaling pathway
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk04920  Adipocytokine signaling pathway
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04940  Type I diabetes mellitus
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05134  Legionellosis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05144  Malaria
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05205  Proteoglycans in cancer
elk05310  Asthma
elk05321  Inflammatory bowel disease
elk05322  Systemic lupus erythematosus
elk05323  Rheumatoid arthritis
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
elk05410  Hypertrophic cardiomyopathy
elk05414  Dilated cardiomyopathy
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111152248
   04350 TGF-beta signaling pathway
    111152248
   04064 NF-kappa B signaling pathway
    111152248
   04668 TNF signaling pathway
    111152248
   04071 Sphingolipid signaling pathway
    111152248
   04150 mTOR signaling pathway
    111152248
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111152248
   04061 Viral protein interaction with cytokine and cytokine receptor
    111152248
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111152248
   04217 Necroptosis
    111152248
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111152248
   04620 Toll-like receptor signaling pathway
    111152248
   04621 NOD-like receptor signaling pathway
    111152248
   04622 RIG-I-like receptor signaling pathway
    111152248
   04625 C-type lectin receptor signaling pathway
    111152248
   04650 Natural killer cell mediated cytotoxicity
    111152248
   04612 Antigen processing and presentation
    111152248
   04660 T cell receptor signaling pathway
    111152248
   04657 IL-17 signaling pathway
    111152248
   04664 Fc epsilon RI signaling pathway
    111152248
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111152248
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111152248
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111152248
  09163 Immune disease
   05310 Asthma
    111152248
   05322 Systemic lupus erythematosus
    111152248
   05323 Rheumatoid arthritis
    111152248
   05321 Inflammatory bowel disease
    111152248
   05330 Allograft rejection
    111152248
   05332 Graft-versus-host disease
    111152248
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111152248
   05014 Amyotrophic lateral sclerosis
    111152248
   05020 Prion disease
    111152248
   05022 Pathways of neurodegeneration - multiple diseases
    111152248
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111152248
   05410 Hypertrophic cardiomyopathy
    111152248
   05414 Dilated cardiomyopathy
    111152248
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111152248
   04940 Type I diabetes mellitus
    111152248
   04932 Non-alcoholic fatty liver disease
    111152248
   04931 Insulin resistance
    111152248
   04933 AGE-RAGE signaling pathway in diabetic complications
    111152248
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111152248
   05135 Yersinia infection
    111152248
   05133 Pertussis
    111152248
   05134 Legionellosis
    111152248
   05152 Tuberculosis
    111152248
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152248
   05170 Human immunodeficiency virus 1 infection
    111152248
   05161 Hepatitis B
    111152248
   05160 Hepatitis C
    111152248
   05171 Coronavirus disease - COVID-19
    111152248
   05164 Influenza A
    111152248
   05168 Herpes simplex virus 1 infection
    111152248
   05163 Human cytomegalovirus infection
    111152248
   05169 Epstein-Barr virus infection
    111152248
   05165 Human papillomavirus infection
    111152248
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111152248
   05144 Malaria
    111152248
   05145 Toxoplasmosis
    111152248
   05140 Leishmaniasis
    111152248
   05142 Chagas disease
    111152248
   05143 African trypanosomiasis
    111152248
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111152248
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Tumor necrosis fators
   111152248
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111152248
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 111152248
NCBI-ProteinID: XP_022366399
UniProt: A0A2Y9K411
LinkDB
Position
Unknown
AA seq 234 aa
MSTESMIRDVELGEEALPKKAGAPKGSRRCWCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EEQLPDGLQLIKPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGMEL
TDNQLIVPSDGLYLIYSQVLFKGQGCSSTNVLLTHTISRFAVSYQTKVNLLSAIKSPCQR
ETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctgggcgaggaggcactccccaagaag
gcaggggcccccaagggctcccgaaggtgctggtgcctcagtctcttctccttcctcctc
gtcgcaggagccaccacactcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagcagctcccagatggcctccaactaatcaaacctctggcccagacagtcaaatca
tcttctcgaactccaagtgacaagcccgtagctcatgttgtagcaaaccctgaagctgag
gggcaactccaatggctgagccggcgtgccaatgccctcctggccaatggtatggagctg
acagacaaccagctaatagtgccatcagacgggctgtacctcatctactcccaggtcctc
ttcaagggccaaggatgttcttccaccaatgtgctcctcacccacaccatcagccgcttc
gctgtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccaaagg
gagaccccagaggggactgaggccaagccctggtacgagcccatctacctgggaggggtc
ttccaattggagaagggggatcgactcagcgctgagatcaacctgcctgactatcttgac
tttgccgaatccgggcaggtctactttggaatcattgccctgtga

DBGET integrated database retrieval system