KEGG   Enhydra lutris kenyoni (northern sea otter): 111152366
Entry
111152366         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04141  Protein processing in endoplasmic reticulum
elk04151  PI3K-Akt signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04918  Thyroid hormone synthesis
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111152366
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111152366
   04022 cGMP-PKG signaling pathway
    111152366
   04151 PI3K-Akt signaling pathway
    111152366
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111152366
   04915 Estrogen signaling pathway
    111152366
   04926 Relaxin signaling pathway
    111152366
   04935 Growth hormone synthesis, secretion and action
    111152366
   04918 Thyroid hormone synthesis
    111152366
   04928 Parathyroid hormone synthesis, secretion and action
    111152366
   04925 Aldosterone synthesis and secretion
    111152366
   04927 Cortisol synthesis and secretion
    111152366
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111152366
  09156 Nervous system
   04728 Dopaminergic synapse
    111152366
  09149 Aging
   04211 Longevity regulating pathway
    111152366
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111152366
  09164 Neurodegenerative disease
   05020 Prion disease
    111152366
  09165 Substance dependence
   05030 Cocaine addiction
    111152366
   05031 Amphetamine addiction
    111152366
   05034 Alcoholism
    111152366
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111152366
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152366
   05161 Hepatitis B
    111152366
   05163 Human cytomegalovirus infection
    111152366
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111152366
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111152366
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 111152366
NCBI-ProteinID: XP_022366586
UniProt: A0A2Y9K0D0
LinkDB
Position
Unknown
AA seq 718 aa
MMGRGGPWEPSHGGGRAGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYTGLDDVAEE
QTQLFRCPEQDVPFGSGSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSES
SHLSTEPSSQASGVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGATSDDPSDVQTK
VEPVSPSSSINSEASLLSAESPNQAFIGEEVLEVKTESPSPQGCLLQDVLGPPLGGVQIS
MGPPSDGSLGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLI
QGALRVQPEGPAPPASRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRR
KKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFL
LFIAFNFGPVSISEPPPAPVSPRMSREEPQPRRRLLEFSMQEPVQGVEPLQGSSLGPEEP
QPSAPGQPSFRNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQ
RGRRKIPQRAQERQKSQLRKSPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAI
DRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGSPGDYEEMMQI
ECEVMDTRVIHIKTSTVPPSLRKQPASTPGNSTGGPLPASAAGQARQASHQPLYLNHP
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgatggggagaggcgggccttgggaaccgtctcatggtggggggcgggcgggaaagatg
gcggaactgatgctcctcagcgagattgcggacccaacacgttttttcacggacaacttg
ctgagcccggaggactgggacagcaccttgtacactggcctggatgatgtggccgaggag
cagacgcagctcttccgctgcccagagcaggatgtcccgtttggcagcggctccctggat
gtggggatggatgtcagcccccctgagccaccttgggaccccctgcctatcttcccagat
cttcaggtgaagtctgagccatcttccccctgctcctcttcctccctcagttccgaatca
tcccatctttccacagagccctccagccaggcctctggtgtaggggaggtgctggttgtg
aagacagagtccttggcacccccactctgcctcctaggagatgatccaacatccccattt
gaaaccgtccagatcaatgtgggtgccacctctgatgacccctcagatgtccagaccaag
gtagaacctgtctctccatcttcctccatcaactctgaggcttccctgctctcagcagag
tcccccaaccaggcttttataggagaggaggtactggaagtgaagacagagtcaccgtcc
cctcaaggctgtctcctgcaggatgtcctgggccccccacttggaggtgtccagatcagc
atgggcccaccctccgatggctccttaggcaaagccctgcccacccggaagccacccctg
cagcccaaacctgtggtgataaccaccgtcccgatgccacccagagctgtgcctcccagc
accaccatccttttgcagccccttgtccagccgcccccagtctccccagttgtcctcatc
caaggtgctcttcgggtccagcctgaggggccggccccccctgcttcaaggcctgagagg
aagagcattgttccagctcctatgcctgggaactcctgcccaccagaagtggatgcaaag
ctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgccagtccaggagg
aagaagaaagagtatctgcaggggttggaggctcgactgcaggcggtgctggctgacaac
cagcagctccgccgggagaacgctgccctccggcggcggctggaggccctgctggctgag
aacagcgagctcaagttggggtctggaaacaggaaggtggtctgcatcatggtcttcctt
ctcttcattgccttcaactttggacctgtcagcatcagtgagcctcctccggctcctgtc
tctcctcggatgagcagagaggagcctcagccccggagacgcttgctggagttctcaatg
caagagccagttcagggagttgaacccctccagggttcctccctgggtcctgaggagccc
cagcccagcgctccaggccagccaagtttcagaaacctgacagccttccccgggggtgcc
aaggagctactgctgagagacctggaccagctcttcctctcctctgattgccggcatttc
aaccggacagagtccctgaggcttgctgatgagctgagcggctgggtccagcgccaccag
agaggccggcggaagattccccagagagcccaggagagacagaagtctcagctgcggaag
tcacctccagttaaggcagtccccacccaacctcctgggcccccagagagggattctgtg
ggccagctgcagctgtatcgccacccagaccgttcacagccagagttcctggacgccatt
gaccgacgagaagacacattttatgttgtgtccttccgaagagaccacttgctgctccct
gccatcagccataacaagacctctcggcccaagatgtccctggtgatgcctgccatggct
cccaatgagaccctgtcaggccgggggtccccaggggactatgaggagatgatgcagatc
gagtgtgaggtcatggacaccagggtgattcacatcaagacctccacggtgcccccctcg
ctccgaaaacagccagcctccaccccgggcaattccacaggtggccccttgccagcttct
gcagccggccaggcccgtcaggcctcccaccagcctctctacctcaatcacccctga

DBGET integrated database retrieval system