KEGG   Enhydra lutris kenyoni (northern sea otter): 111152643
Entry
111152643         CDS       T05871                                 

Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04114  Oocyte meiosis
elk04140  Autophagy - animal
elk04144  Endocytosis
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04510  Focal adhesion
elk04520  Adherens junction
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04730  Long-term depression
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05205  Proteoglycans in cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111152643
   04014 Ras signaling pathway
    111152643
   04015 Rap1 signaling pathway
    111152643
   04066 HIF-1 signaling pathway
    111152643
   04068 FoxO signaling pathway
    111152643
   04151 PI3K-Akt signaling pathway
    111152643
   04152 AMPK signaling pathway
    111152643
   04150 mTOR signaling pathway
    111152643
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111152643
   04140 Autophagy - animal
    111152643
  09143 Cell growth and death
   04114 Oocyte meiosis
    111152643
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111152643
   04520 Adherens junction
    111152643
   04550 Signaling pathways regulating pluripotency of stem cells
    111152643
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    111152643
   04914 Progesterone-mediated oocyte maturation
    111152643
  09156 Nervous system
   04730 Long-term depression
    111152643
  09149 Aging
   04211 Longevity regulating pathway
    111152643
   04213 Longevity regulating pathway - multiple species
    111152643
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111152643
   05202 Transcriptional misregulation in cancer
    111152643
   05205 Proteoglycans in cancer
    111152643
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111152643
   05214 Glioma
    111152643
   05218 Melanoma
    111152643
   05215 Prostate cancer
    111152643
   05224 Breast cancer
    111152643
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111152643
   01522 Endocrine resistance
    111152643
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111152643
Protein kinases [BR:elk01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   111152643
CD molecules [BR:elk04090]
 Proteins
  111152643
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 Insulin_TMD
Other DBs
NCBI-GeneID: 111152643
NCBI-ProteinID: XP_022366891
UniProt: A0A2Y9K178
LinkDB
Position
Unknown
AA seq 1367 aa
MKSGSGGGSPTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTSRCQKMCPSACGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPTCPPNTYRFEGWRCVDRDFCANIPNAESNDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDILHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLQGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVTQVTNTTMSSRGRNTTVVDTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
ESRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVPAKITYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEIENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSVKDEMEPGFREVSFYYSEDNKPPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttttctcc
gccgcgctctcgctctggccgacgagtggagaaatctgcgggccgggcatcgacatccgc
aatgactatcagcagctaaagcgcctggagaactgcacggtgatcgaaggctacctccac
atcctgctcatctccaaggcagaggactaccgcagctaccgcttccccaagctcacagtc
atcaccgagtacctgctgctgttccgcgtggccggcctcgagagccttggggacctcttc
cccaacctcacggtcatccgcggctggaaactcttctacaactatgccctggtcatcttt
gagatgaccaatctcaaggatattggactttacaatctgaggaacatcacccggggggcc
atcaggattgagaagaatgctgacctctgttacctctccacggtggactggtccctgatc
ctggatgcggtgtccaataactacatcgtggggaacaagcccccgaaggagtgcggggac
ctgtgtccggggacgatggaggagaagcccttgtgcgagaagacgaccatcaacaacgag
tacaactatcgctgctggaccaccagccgctgccagaaaatgtgcccgagcgcgtgcggg
aagcgcgcatgcaccgagaacaacgagtgctgtcaccccgagtgtctgggcagctgcagc
gcgcccgacaacgacacggcctgcgtggcctgcagacattactattacgccggcgtgtgc
gtgccaacctgcccgcccaacacctaccgcttcgagggctggcgctgcgtggaccgcgac
ttctgcgccaacatccccaatgccgagagcaacgactccgaggggttcgtcatccacgac
ggcgagtgcatgcaggagtgcccctctggcttcatccggaacggcagtcagagcatgtac
tgcatcccttgtgaaggtccttgccccaaggtctgcgaggaagaaaagaagacaaagacc
attgattctgttacctctgctcagatgctccaaggatgtaccattttcaagggcaatttg
ctcattaatattcgccgaggcaataacattgcctcagaactggagaacttcatggggctc
attgaggtggtgacaggctacgtgaagatccgccattctcacgccttggtctccttgtcc
ttcctaaaaaaccttcgccagatcttaggagaggagcagctcgaggggaactactccttc
tatgtcctcgacaaccagaacttgcagcagctgtgggactgggaccatcgcaacctgacc
atcaaagctgggaagatgtactttgctttcaatcccaaattgtgcgtgtccgagatttac
cgcatggaggaggtgacggggacgaaaggacgccagagcaaaggagacataaacaccagg
aacaacggagagcgagcgtcctgtgaaagcgacatcctgcacttcacctctacgaccacg
tggaagaaccgcatcatcataacgtggcaccgttaccggccccctgactacagggacctc
atcagcttcaccgtctactacaaggaagcaccttttaaaaacgtcacggagtatgacggg
caggatgcctgtggctccaacagctggaacatggtagatgtggacctccctcccaacaag
gatgttgagcctggcattttactgcaaggactaaagccctggacgcagtacgcggtgtat
gtcaaggcggtgaccctcaccatggtggagaacgaccacatccgcggggccaagagtgaa
atcttgtacattcgcaccaatgcttcagttccttccattcccctggacgttctctccgcg
tccaactcctcttcccagctcatcgtgaagtggaacccgccgtccttgcccaacggcaac
ctcagttactacatcgtgaggtggcaacggcagccccaggacagctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtacgccgatggcaccatcgacgtc
gaggaggtgacggagaatcccaagactgaggtgtgcggcggagagaaggggccttgctgc
gcctgccccaaaacggaggccgagaagcaggccgagaaggaggaggccgagtaccgcaaa
gtctttgagaacttcctgcacaactccatctttgtgcccagacctgaaaggaagcggaga
gatgtcacacaagtcaccaacaccaccatgtccagccgaggcaggaacaccacagtggta
gacacctataatatcacagacccagaagagctcgagacagaataccctttctttgagagc
agagtggataacaaggagagaactgtaatctccaacctgcggcctttcactttgtaccgc
attgacatccacagctgtaaccatgaggctgagaagctgggctgcagcgcctccaacttt
gtttttgcaagaaccatgcctgcagaaggggcagatgacattcctgggccggtgacctgg
gagtcgaggcctgaaaactccatctttcttaagtggccagaacctgagaatcccaacgga
ctgattctcatgtatgaaataaaatatggatcacaagtcgaggaccagcgggagtgcgta
tcaagacaggagtacaggaagtatgggggtgccaagcttaaccggctcaacccggggaac
tacacggcccggatccaggccacctctctctccgggaatgggtcctggacagacccggtg
ttcttctacgtcccagccaaaataacgtacgaaaacttcatccacctgatcatcgctctg
cccgtcgctgtcctgctgatagtggggggacttgttataatgctgtacgtcttccacagg
aaaaggaataacagcaggctgggcaatggagtgctgtatgcttctgtgaacccagagtat
ttcagcgccgccgatgtgtacgtgcctgacgagtgggaggtcgctcgagagaagatcacc
atgagccgcgagctggggcagggctcctttgggatggtgtacgaaggagtcgccaaaggc
gtggttaaagatgagcccgaaaccagggtggccattaaaacagtgaacgaggctgccagc
atgcgcgaaaggattgaatttctcaatgaggcttcagtgatgaaggagttcaactgtcac
cacgtggtgcggttgctgggtgtggtgtcccagggccagccgacgctggtcatcatggaa
ctgatgacgcggggggatctcaaaagctatctcaggtctctgaggccagaaatagagaat
aatccagtcctagcacctccaagcctaagcaagatgatccagatggctggggagatcgca
gacggcatggcatacctcaacgccaacaagtttgtccacagagacctggctgcccggaac
tgcatggtggccgaagatttcacggtcaaaatcggagattttggtatgacgagagacatc
tacgagacagactattaccggaaaggaggaaaggggctgctgcctgtgcgctggatgtcc
cccgagtctctcaaggatggagtcttcaccactcactctgacgtctggtccttcggggtc
gtgctctgggagatcgccacgctggccgagcagccctaccagggcttgtccaacgagcag
gtccttcgcttcgttatggaaggcggccttctggacaagccggacaactgtcccgacatg
ctgttcgagctgatgcgcatgtgctggcagtacaaccccaagatgaggccctccttcctg
gagatcatcagcagcgtcaaggatgagatggagcccggcttccgggaggtgtccttctac
tacagcgaggacaacaagccacctgagccggaggagctggacctggagcccgagaacatg
gagagcgtccccctggacccctccgcctcctcgtcctccctgccgctgcccgacagacac
tcaggacacaaggccgagaacggcccaggccctggcgtgctggtgctccgagccagcttc
gacgagagacagccttacgcgcacatgaacgggggacgcaagaacgagagggccttgcct
ctgccccagtcttcgacctgctga

DBGET integrated database retrieval system