KEGG   Enhydra lutris kenyoni (northern sea otter): 111152800
Entry
111152800         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cadherin-1-like
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04015  Rap1 signaling pathway
elk04371  Apelin signaling pathway
elk04390  Hippo signaling pathway
elk04514  Cell adhesion molecules
elk04520  Adherens junction
elk05100  Bacterial invasion of epithelial cells
elk05200  Pathways in cancer
elk05213  Endometrial cancer
elk05216  Thyroid cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111152800
   04390 Hippo signaling pathway
    111152800
   04371 Apelin signaling pathway
    111152800
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111152800
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111152800
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111152800
  09162 Cancer: specific types
   05226 Gastric cancer
    111152800
   05216 Thyroid cancer
    111152800
   05218 Melanoma
    111152800
   05219 Bladder cancer
    111152800
   05213 Endometrial cancer
    111152800
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111152800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111152800
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:elk04515]
    111152800
   04090 CD molecules [BR:elk04090]
    111152800
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111152800
Cell adhesion molecules [BR:elk04515]
 Cadherins
  Major cadherins
   111152800
CD molecules [BR:elk04090]
 Proteins
  111152800
SSDB
Motif
Pfam: Cadherin Big_9
Other DBs
NCBI-GeneID: 111152800
NCBI-ProteinID: XP_022367151
UniProt: A0A2Y9K1V8
LinkDB
Position
Unknown
AA seq 641 aa
MTPIFGPRLHRKIQPLERTKKCLAEAKVLLLRQRAGLCTCRLPSPSPDTVIAKDRQVDSP
WTTECQQLRLQGSVAVASTTRRSTTAMASTTYFLLCLSATQLFAHGTPSSKGTPKIPQKL
GLMLEGLHANKTLQQGILSGHHTKVLTFPHAHFGPRRXKRDWVVPPISIPENEXGPNPKT
VAQVKSNKNKEIQVFYSITGRGADEPPCGVFIMDRETGWLKVTGPLDREQESHYVLFLHA
VSSTGNAVEDPMETVITVXDQNDNRPEFTQAVFEGSVMEGAYPGTSVMQITATDADDHEN
TDNADIAYTILSQDPSLPHSNMFSINRDMGVISVLTTELDQQSVPAYTLTVQAADLQGEG
LRSTTAVITVTQSNGSPPVFSPTQYAGQVFENKVGAGIVRLKVKDADTPGTPAWKAVFSI
LNDRSRLFTVTTDPKTNDGLLKTAKGLDFEATQRYILYVTVANTVPFAPSLPTATATVTV
DVLDMNEAPVFVPPIKTVEVPKDVVAGQEITSYRAQDPDSLQGQRIRYQMWDSPSRWLDI
NSETGVISTRASLHNDDMENHTFSAIVIAVDDGQPPDTGTGTLLLTFSDPDGPTADSHCL
SSCQRGPELPAVTPEHQDLSLKHGALTRENGDNTSDVMKLS
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgactcctatttttggtccacgtctccacaggaagattcaacccctggaaaggaccaag
aagtgcttagctgaggccaaggtcctcctcctgcgacaacgggctggcctctgcacctgc
cggcttcccagcccctcccctgacactgtgattgccaaggacaggcaggtcgatagtcct
tggaccacagaatgtcagcagctgagactacagggcagtgtggcagtggcctccaccaca
cgccgctccaccacagctatggccagcaccacctactttctgctctgcttgtctgccacc
cagctctttgcccatgggacgccttccagtaaggggacgcccaagatacctcagaagctg
gggctgatgctggaaggtctgcacgccaacaagaccctccagcagggtatcctctctgga
caccacacgaaggtgctgacgttccctcatgcccactttggtcccaggaggnncaagaga
gactgggttgtccctcccatctccatcccagagaatgagnnaggcccaaaccccaaaaca
gtggctcaggtcaaatcgaacaagaacaaggaaatccaggttttctatagcatcacgggc
aggggcgctgacgagcctccgtgtggcgtgttcatcatggacagagaaacagggtggctc
aaggtcacggggcccctggacagagagcaggaatcccactatgttctgttccttcatgct
gtgtcttcgactgggaatgctgtggaggacccgatggaaactgtgatcacagtgnnagac
cagaacgacaacaggccggaattcacccaggcggtctttgaggggtccgtgatggaagga
gcctacccaggaacatccgtgatgcaaatcacagcaacggacgcggacgaccacgagaac
acagacaacgcagacattgcctacaccatcctcagccaggacccctcgctgcctcactcc
aacatgttctccatcaaccgggacatgggagtcatctctgtgctcactactgagctggac
caacagagcgtgcctgcctacaccctgacggtccaggctgccgacctccaaggggagggc
ctacgctccacaacagccgtgatcacagtcacccagagcaacggcagccctcccgtcttc
agccccactcagtacgcgggccaggtgtttgagaacaaggtgggcgccgggatagtgagg
ctaaaagtgaaggacgcagacaccccgggcacccctgcatggaaggcagtgttctccatc
ctgaatgacagatcccgcctcttcactgtcaccacagaccccaagaccaatgacggcctt
ttgaaaacagccaagggcttggattttgaggccacacagcgatacatcctctacgtgaca
gtggcgaacaccgtgccctttgcaccgtctctccccacagccacagcgaccgtcactgtg
gacgtgctggacatgaatgaggcccctgtctttgtgcccccaataaagacggtggaagtg
cccaaggatgtggttgcgggccaggaaatcacatcatacagggcccaggacccagacagc
ctccagggtcagagaatcaggtaccagatgtgggacagcccaagccgttggctggacatc
aactcagaaacaggcgtcatttccactcgagccagtctgcacaacgatgacatggagaac
cacacattttcggccattgtcatagctgtggatgatgggcaacctcctgacacgggcacc
gggacgcttctcctcactttctcggacccagatggcccaacagcagactcgcactgcctt
tcctcctgccagaggggaccagagctcccagctgtgactccagagcaccaggacctttca
ctgaaacatggggcactgactcgagaaaatggggataacaccagtgacgtcatgaagctg
tcgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152817
Entry
111152817         CDS       T05871                                 

Definition
(RefSeq) cadherin-1 isoform X1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04015  Rap1 signaling pathway
elk04371  Apelin signaling pathway
elk04390  Hippo signaling pathway
elk04514  Cell adhesion molecules
elk04520  Adherens junction
elk05100  Bacterial invasion of epithelial cells
elk05200  Pathways in cancer
elk05213  Endometrial cancer
elk05216  Thyroid cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111152817
   04390 Hippo signaling pathway
    111152817
   04371 Apelin signaling pathway
    111152817
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111152817
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111152817
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111152817
  09162 Cancer: specific types
   05226 Gastric cancer
    111152817
   05216 Thyroid cancer
    111152817
   05218 Melanoma
    111152817
   05219 Bladder cancer
    111152817
   05213 Endometrial cancer
    111152817
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111152817
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111152817
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:elk04515]
    111152817
   04090 CD molecules [BR:elk04090]
    111152817
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111152817
Cell adhesion molecules [BR:elk04515]
 Cadherins
  Major cadherins
   111152817
CD molecules [BR:elk04090]
 Proteins
  111152817
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3 Big_9 DUF4999 Cadherin_4
Other DBs
NCBI-GeneID: 111152817
NCBI-ProteinID: XP_022367182
UniProt: A0A2Y9K169
LinkDB
Position
Unknown
AA seq 885 aa
MGPRYPSVCALLLLLQVSSWLCQEPGPCRPGFGSDSYTFTVPRRHLERGRVLGRVSFEGC
TGRPGTAYNADDTRFKVNADGVVTVKRPLQLHKPELSFLVHAWDSSRRKLSARVTLKAAE
HRDHHHRHHHHDAISETQTEVLTFPNSQRGLRRQKRDWVIPPISCPENEKGPFPKNLVQI
KSNRDKEIKVFYSITGQGADTPPVGVFVIERETGWLKVTEPLDREQIAKYILYSHAVSSN
GNAVEDPMEIVITVTDQNDNKPEFTQEVFEGSVMEGALPGTSVMQVTATDADDDVNTYNA
AIAYRIVTQDPLLPSSMMFTINKDTGVISVLTTGLDREKIPMYTLVVEAADLQGEGLSTT
ATALITITDINDIAPVFQPTTYQGRVPENKANVEIAVLKVTDDDVPNTPAWQAVYTILNN
NDEKFVVTTDPVTNDGILKTAKGLDFEAKQQYILYVTVVNVAPFEVILSTSTATVTVDVE
DVNEAPVFVPCPKEVRIPEDFGVGLEITSYTAKDPDQFMEQSITYRIWRDAAGWLEINPE
SGAIFTRAELDREDTEHVKNSTYEAIIIAVDNGSPVATGTGTLLLILSDVNDNGPVPEPR
NMDFCQKSPQPHVINIIDPDLPPNTSPFTAELTHGASVNWTIEYNDQAHESLILKPKKTL
ELGDYKINLKLTDNQNKDQVTTLDVYVCDCEGVTNNCKRVAPYAEAGLQVPAILGILGGI
LALLILILLLLLFVRRRGVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLE
ARPEVTRNDVAPTLLSVPHYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEG
SGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgggccctcggtaccctagcgtctgcgcgctcctgctgctactgcaggtctcatcgtgg
ctctgccaggagccagggccctgtcgtcctggctttggctctgacagttacacgttcaca
gtgccccggcgacatttagagagaggccgagtcctgggcagagtgagttttgaaggatgc
actggccggccagggacggcctacaatgctgatgacacgcgattcaaagtgaacgcagat
ggtgtggtgactgtcaagcgacctctacaacttcataaaccggagctgagttttctggtc
cacgcctgggactccagccgcaggaagctctctgccagagtcacgctgaaggcagccgag
caccgtgaccaccatcaccgccaccaccatcatgatgctatctctgaaacccagacagaa
gtgctcacatttccgaactcccagcgtggtctcagaagacagaagagagactgggttatc
cctcctatcagctgcccagaaaatgagaaaggcccatttcctaaaaatctggttcagatc
aaatctaacagagacaaagaaatcaaggttttctacagcatcactggtcaaggagctgac
acacctccggttggtgtatttgttattgaaagagaaacgggatggctgaaggtgacagag
cctctggatagagaacaaatcgccaagtacatcctctattctcacgccgtgtcttctaat
gggaatgcagtcgaagacccaatggagatcgtgatcactgtgactgatcagaatgacaac
aagcctgagttcacccaggaggtctttgaaggatctgtcatggaaggtgctctgccaggc
acctccgtgatgcaggtcacggccacagatgcggatgacgacgtgaacacctacaacgcc
gccatcgcttaccgcatcgtcacccaagaccccctcctgcccagcagcatgatgttcact
atcaacaaggacacaggagtcatcagcgtgctcaccaccgggttggaccgggagaaaatt
cccatgtacaccctggtggtcgaggctgccgacctgcaaggtgaagggttaagtacaacc
gcaacggctctgatcacaatcactgacatcaacgatatcgcccccgtcttccagcccacc
acgtaccaggggcgggtgcctgagaacaaggccaacgttgaaatcgccgtactcaaagtg
actgatgacgatgtccccaataccccagcatggcaggccgtgtacaccattttgaacaat
aacgatgagaagtttgttgtcaccacagacccagtaaccaacgacggcattttgaaaaca
gctaagggcttggatttcgaggccaagcagcagtatattctgtatgtgaccgtcgtgaat
gtagccccgtttgaggtcattctctccacctccacggccactgtcactgtggacgtggag
gacgtgaatgaagcccccgtctttgtgccttgcccaaaggaagtgcgcatacctgaagac
ttcggtgtgggcctggaaatcacgtcttacactgccaaagacccggaccagttcatggaa
cagagcataacgtaccggatttggagggatgctgccggttggctggagattaatccagaa
tctggtgccattttcactcgggctgagctggacagagaggacacagagcatgtgaagaac
agcacgtacgaggccatcattatagccgttgacaacggttctccagttgctactggaacg
ggaaccctcctcctgatcctctctgatgtgaatgacaatggccctgtaccagaacctcga
aatatggacttctgccagaagagtccacagcctcatgtcatcaacatcattgacccagat
cttccgcccaacacatctcccttcacagcagaactaacgcatggggcaagtgtcaactgg
accattgagtacaatgaccaagcccatgaatctctaattttgaagccgaaaaaaacctta
gagttgggtgactacaaaataaatctcaagctcacggataaccagaacaaggaccaggtg
accaccctagatgtgtacgtgtgcgactgtgaaggggtcaccaacaactgcaagagggtg
gcgccatacgcagaggcaggcttgcaggttcctgccattctgggcattctcggaggaatc
ctcgctttactaatcctcattctgctgcttctgctgtttgttcggaggagaggggtggtc
aaagagcccttactacccccagaagatgacacccgggacaacgtttactactatgatgaa
gaaggaggtggagaagaggatcaggactttgacttgagccagttgcacaggggcctggaa
gctcggccggaagtaactcgcaatgatgtggcgccaaccctcctgagtgtgccccattac
ctgccccgccctgccaatcctgatgaaattggaaactttattgatgaaaacctgaaggca
gcagacactgaccccactgctcctccttacgactctctgctggtgtttgactatgaaggg
agtggttccgaagctgctagtctgagctccttgaactcctcagagtcagaccaagaccag
gactatgactacctgaacgaatggggcaatcgcttcaagaagctggcggacatgtacgga
ggtggcgaggacgactag

DBGET integrated database retrieval system