KEGG   Enhydra lutris kenyoni (northern sea otter): 111152832
Entry
111152832         CDS       T05871                                 

Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04064  NF-kappa B signaling pathway
elk04071  Sphingolipid signaling pathway
elk04210  Apoptosis
elk04217  Necroptosis
elk04622  RIG-I-like receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04668  TNF signaling pathway
elk04920  Adipocytokine signaling pathway
elk05132  Salmonella infection
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111152832
   04064 NF-kappa B signaling pathway
    111152832
   04668 TNF signaling pathway
    111152832
   04071 Sphingolipid signaling pathway
    111152832
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111152832
   04217 Necroptosis
    111152832
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111152832
   04657 IL-17 signaling pathway
    111152832
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111152832
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111152832
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111152832
   05152 Tuberculosis
    111152832
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111152832
   05160 Hepatitis C
    111152832
   05164 Influenza A
    111152832
   05162 Measles
    111152832
   05168 Herpes simplex virus 1 infection
    111152832
   05163 Human cytomegalovirus infection
    111152832
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152832
   05169 Epstein-Barr virus infection
    111152832
   05165 Human papillomavirus infection
    111152832
SSDB
Motif
Pfam: TRADD_N Death HpaP RNA_binding
Other DBs
NCBI-GeneID: 111152832
NCBI-ProteinID: XP_022367209
UniProt: A0A2Y9K6B6
LinkDB
Position
Unknown
AA seq 314 aa
MATGPNGLDEWVGSAYLFVESSLDKVVLSDAYAQAQQKVPVYRALRTALTESGGSPDVLQ
MLKIHLSEPQLIVQVRFRGRQPCSRFLRAYREGSLRAALQECLAAALSLHSVPLQLELRA
GTERLDTLLTDEERCLSCIFAQKPDRLRDEELSELEEALRNLACCSGSQGGNTEVVPAPS
QSLATSLSEEKPLPPPPPPPVQTFLFQGQPIVNRPLSLQDQQTFARSVGVKWRKVGRSLQ
RGCRALRDPALDSLAYEYEREGLYEQAFQMLRRFVQAEGRRATLQRLVEALEENELTSLA
EDLLGLTNPDGSLA
NT seq 945 nt   +upstreamnt  +downstreamnt
atggcgactgggccaaatgggctcgatgagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctatctgatgcctatgctcaggcccagcagaaggtgccg
gtgtacagagctctgcggactgcactgacagagagtggcgggagcccagacgtactgcag
atgctcaagatccacctcagcgagccccagctgattgtgcaggtgcgtttccgcgggcgc
cagccctgcagccgctttctccgcgcttaccgcgaggggtcgctgcgcgctgcgctgcaa
gagtgcttggcggcggctctctccctgcactctgtgccgctgcaactggagctgcgcgcc
ggcacggagcggctggacaccttgctgacggatgaggaacgctgtttgagttgcatcttc
gcccagaagcctgaccggctccgggacgaggaactctctgagttggaggaggcgctccgg
aatctggcgtgctgctcggggagccagggtggcaacacagaggtcgttccagcgccctcg
cagtccctggccacctctctctcagaggagaagccgctgccaccaccgccgccgccgcct
gtccagacttttctgttccagggtcagcccatagtgaaccggccgctgagcttgcaggac
caacagacgtttgcgcgttcagtgggtgtcaaatggcgcaaagtggggcgctctctgcag
cgaggctgtcgtgcgctgcgggacccggcgcttgattcactggcctatgagtatgagcgc
gaagggctgtacgagcaggccttccagatgctgcgacgcttcgtgcaggcagagggccgc
agggccacgctgcagcgcctggtagaggcccttgaggagaacgagctcaccagcctggca
gaggacttgctgggcctcacaaatcccgatggcagcctggcctaa

DBGET integrated database retrieval system