KEGG   Enhydra lutris kenyoni (northern sea otter): 111153386
Entry
111153386         CDS       T05871                                 

Definition
(RefSeq) telomerase reverse transcriptase isoform X1
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111153386
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111153386
   05226 Gastric cancer
    111153386
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111153386
   05165 Human papillomavirus infection
    111153386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:elk03032]
    111153386
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     111153386
DNA replication proteins [BR:elk03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    111153386
   Telomerase complex (fungi)
    111153386
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 111153386
NCBI-ProteinID: XP_022368087
UniProt: A0A2Y9K3J1
LinkDB
Position
Unknown
AA seq 1191 aa
MPRAPRCRAVRALLRSRYREVLPLASFLRRLGPQGRRLVRRGDPAAFRALVAQCLVCVPW
DARPPPVAPSFRQVSCLKELVARVVQRLCERGARNVLAFGFALLDGARGGPPLAFTTSVR
SYLPNTVTETLRGSGAWGLLLRRVGDDVLAHLLTCCALYVLVAPSCAYQVCGPPLYDLCV
PAAVSRPLGSPGHSPGTWKDLRPTRQAWKSGARRRRRRGKSGSSPPLAKRPRRGVTPEPE
QGTQRPSAQAHLGRAHGPGDNKPHAVTPARVAAEAASWEGGPLGTRLSSAAAQPSQGPQG
VPHQPAHPETKHFLYCSGGRERLRPSFLLSALPPSLTGARKLVETVFLGSTARRAGAAHR
TRRLPARYWRMRPLFQELLGNHARCPYRALLRTHCPLRAEAPGAASSKQARGGVGVCPLE
RPVAAPEENADPRRLVRLLRQHSSPWQVYAFLRACLGRLVPPALWGSRHNQRRFLRNVKK
FISLGKHAKLSPQELTWKMKVQDCAWLRGSPGARSVPAAEHRRREGVLARLLCWLMGTYV
VELLRSFFYVTETTFQKNRLFFYRKSVWSPLQTLGVRQHCTSVRLRELSAAEVRRQHEAR
ATLLTSRLRFLPKPGGLRPIVNMDYVAGARTLCRDKKIQHLTSQVKTLFSVLNYERARRP
RLLGASVLGMDDIHRAWHDFVLRVRARDPAPRLYFVKVDVTGAYDALPQDRLAEVVANVL
RPHENTYCLRRYAVVRRTAQGHVRRSFKRHVSTFTDLPPYMRQFVERLQETSSLRDSVVI
EQSYSLNEASSGLFHLFLSLVYNHVIRIGGKSYVQCQGIPQGSVLSTLLCSLCYGDMERR
LFPGIQQDGLLLRLVDDFLLVTPHLKRAQAFLRTLVRGVPEYGCLANLQKTAVNFPVEDM
ALGSAAPLQLPAHCLFPWCGLLLDTQTLEVSCDYSSYARTSIRSSLTFSQGARPGRSLRY
KLFALLRLKCCALFLDLQVNSVRTVYANVYKIFLLQAYRFHACVLQFPFDQPVRKNPAFF
LRIISDTASRCYSLLKARNTGVRGGPGLLGAADRFCGVACGTGSVRALPGTLTAWLRALG
ARLSGLGVSAPPVPPLVLSTSCIDPGPQWRGGEAPAGLQPGLPPGVPRTIPAPLCFIPEA
AGPSVTQAAPCPSGLFYFVWCGLLLRTGPKRPESGFPGACFGADLELTLPV
NT seq 3576 nt   +upstreamnt  +downstreamnt
atgccgcgcgcgccccggtgccgcgccgtgcgcgctctgctgcggagccgttaccgggag
gtgctgcccctggcctccttcctgcggcgcctggggccccagggccggaggctggtgcgg
cgcggggacccggcggccttccgcgcgctggtggcccagtgcctggtgtgcgtgccctgg
gacgcgcggccaccccccgtcgccccgtccttccgccaggtgtcctgcctgaaggagctg
gtggcccgggtggtgcagaggctgtgcgagcgcggcgccaggaacgtgctggctttcggc
ttcgccctgctagacggggcccgcggcgggccgcccctggccttcaccaccagcgtgcgc
agctacctgcccaacaccgtgacggaaactctgcgcggcagcggcgcgtgggggctgctg
ctgcgccgcgtgggcgacgatgtgctcgcccacctgctcacgtgctgcgcgctctacgtg
ctggtggccccgagctgcgcctaccaggtgtgtgggcctccgctctacgacctctgcgtc
cccgccgccgtgtctcggcccctcgggtcccccggccacagtcctgggacctggaaggac
ctcagacccacgcgccaggcctggaagtctggcgcaaggcggcggcggcggcggggcaaa
tccgggagcagtccgcctctagccaagaggcccaggcgcggcgtgaccccggagcccgag
caggggacccagaggccgtctgcccaggcccacctgggcagggcgcatgggccgggtgac
aacaaacctcacgcagtgacacctgccagggtcgctgcagaagctgcctcttgggaggga
gggccccttgggactcgtctcagctccgctgcggcacagccatctcagggaccccaggga
gtaccccatcagccagcgcaccccgaaaccaagcacttcctctactgctcaggaggcagg
gagcggctgcgcccctccttcctgctcagcgccctgccgcctagcctgaccggggcccgg
aaactcgtggagaccgtctttctgggctccacggcccggagggcaggggctgcccacagg
acgcgccgccttcccgcacgctactggcggatgcggcctctgttccaggagctgcttggg
aaccatgcgcggtgcccttaccgcgcgctcctcaggacgcactgcccgcttcgggcggag
gccccgggagcggcgtccagcaagcaggcccgtggaggagtgggcgtctgccctttggag
aggcccgtggcagccccggaggagaacgcggacccccggcgcctggtccggcttctccgg
cagcacagcagcccctggcaggtgtacgctttcctgcgggcctgcctgggccggctggtg
cccccagcgctctggggctccaggcacaaccagcgccgcttcttgaggaacgtgaagaag
ttcatctctctgggcaagcacgccaagctctcgccccaggagctgacgtggaagatgaaa
gtgcaggactgtgcctggctgcgggggagcccaggggctcgcagtgtgccggccgccgag
caccgccgcagagaaggggtcctggccaggctcctgtgctggttgatgggcacctacgtg
gttgagctgctcaggtcgtttttctacgtcacggaaaccacgtttcagaagaaccggctc
ttcttctaccggaagagcgtctggagcccgttacagaccctgggagtcagacagcactgc
accagcgtgcgcctccgagagctgtccgccgcagaggtccgaagacagcacgaagccagg
gcgactctcctgacgtccagactccgcttcctccccaagcccggtgggctgcggccgatc
gtgaacatggactatgtggcgggagccagaaccttgtgccgagacaagaagatccagcat
ctcacctcgcaagtgaagacgctgttcagcgtgctgaactatgagcgggcccggcgcccc
agactcctgggggcctctgtgctgggcatggacgacatccacagggcctggcacgacttt
gtgctgcgtgtgcgggcccgggatccagcgccccgcctgtacttcgtcaaggtggacgtg
acgggggcgtatgatgccctgccccaggacaggctggccgaggtcgtcgccaacgtgctc
aggcctcatgaaaacacctactgcttgaggcgctacgccgtggtccggagaaccgcccag
gggcacgtccgcaggtccttcaagagacatgtgtccaccttcacagacctcccgccgtac
atgagacagtttgtggagcgtttgcaggagacgagctcgctcagggactctgtggttatc
gagcagagctactctctgaacgaagccagcagcggccttttccaccttttcctgagcttg
gtgtacaaccacgtcataaggatcgggggcaagtcgtatgtccagtgtcaggggatccca
cagggctccgtcctgtccaccctgctgtgcagcctgtgttacggggacatggagcgcagg
ctgtttcctggcatccagcaggacggcctgctcctgcgtctggtggacgacttcctgctc
gtcacgccccacctgaagcgagcacaggccttcctcaggacgctggtcaggggcgtcccc
gagtatggctgcttggcgaacttgcagaagacggcagtgaactttcccgtggaggacatg
gccctgggcagcgcggcacccctccagctgccggcccactgcctgttcccctggtgtggc
ttgctgctggacacccagaccctggaggtgtcctgtgactactccagttacgcccgcacg
tccatccgctcgagcctgaccttcagccagggcgcccggcccgggaggagcctgcggtac
aagctgtttgcgctcctgcggctcaagtgctgcgccctgttcctggacctgcaggtgaac
agcgtccgcacggtttatgcaaacgtttacaagatattcctgctgcaggcctacaggttc
cacgcgtgtgtgctccagtttccgtttgaccagccggtgaggaagaaccccgccttcttc
ctccgcatcatctcagacaccgcgtcacgctgctactccctcctgaaagccaggaacaca
ggtgtgcgtggagggccggggttactgggtgcggctgaccggttttgtggggtcgcctgt
ggcactggcagtgtacgggcgctccccggcacacttacggcgtggctgcgggctctggga
gctcgcctgtcgggcctgggggtgtcggcaccccctgtcccccctttggtgctctcgacc
tcgtgcatagatccaggcccacagtggagaggaggcgaggccccagccggtctgcagcct
ggccttcctccaggcgtcccgaggaccatccctgccccgctctgcttcatcccagaagcc
gctggcccgtctgtaactcaggccgcgccgtgtccctcgggcctgttttacttcgtttgg
tgcgggttgcttttgagaacaggaccaaagcgcccagagtcagggttccctggggcctgt
tttggggctgaccttgaattgacgttgcccgtttga

DBGET integrated database retrieval system