KEGG   Enhydra lutris kenyoni (northern sea otter): 111153498
Entry
111153498         CDS       T05871                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04062  Chemokine signaling pathway
elk04071  Sphingolipid signaling pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk05010  Alzheimer disease
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05135  Yersinia infection
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111153498
   04371 Apelin signaling pathway
    111153498
   04020 Calcium signaling pathway
    111153498
   04071 Sphingolipid signaling pathway
    111153498
   04022 cGMP-PKG signaling pathway
    111153498
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111153498
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111153498
   04062 Chemokine signaling pathway
    111153498
  09152 Endocrine system
   04911 Insulin secretion
    111153498
   04922 Glucagon signaling pathway
    111153498
   04929 GnRH secretion
    111153498
   04912 GnRH signaling pathway
    111153498
   04915 Estrogen signaling pathway
    111153498
   04921 Oxytocin signaling pathway
    111153498
   04935 Growth hormone synthesis, secretion and action
    111153498
   04918 Thyroid hormone synthesis
    111153498
   04928 Parathyroid hormone synthesis, secretion and action
    111153498
   04916 Melanogenesis
    111153498
   04924 Renin secretion
    111153498
   04925 Aldosterone synthesis and secretion
    111153498
   04927 Cortisol synthesis and secretion
    111153498
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111153498
   04270 Vascular smooth muscle contraction
    111153498
  09154 Digestive system
   04970 Salivary secretion
    111153498
   04971 Gastric acid secretion
    111153498
   04972 Pancreatic secretion
    111153498
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    111153498
  09156 Nervous system
   04724 Glutamatergic synapse
    111153498
   04725 Cholinergic synapse
    111153498
   04728 Dopaminergic synapse
    111153498
   04726 Serotonergic synapse
    111153498
   04720 Long-term potentiation
    111153498
   04730 Long-term depression
    111153498
   04723 Retrograde endocannabinoid signaling
    111153498
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111153498
  09159 Environmental adaptation
   04713 Circadian entrainment
    111153498
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111153498
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111153498
   05016 Huntington disease
    111153498
   05017 Spinocerebellar ataxia
    111153498
   05022 Pathways of neurodegeneration - multiple diseases
    111153498
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111153498
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111153498
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111153498
   05163 Human cytomegalovirus infection
    111153498
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111153498
   05142 Chagas disease
    111153498
   05143 African trypanosomiasis
    111153498
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111153498
   04031 GTP-binding proteins [BR:elk04031]
    111153498
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111153498
GTP-binding proteins [BR:elk04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    111153498
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 111153498
NCBI-ProteinID: XP_022368263
UniProt: A0A2Y9K584
LinkDB
Position
Unknown
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagctcggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacgggagagagcggcaagagtacgtttatcaagcagatgaga
atcatccacgggtcgggctactccgatgaagacaaaaggggcttcaccaagctggtgtat
cagaacatcttcacagccatgcaggctatgatcagagccatggacacgctcaagatcccc
tataagtacgagcataataaggctcatgcacagttggttcgagaagtcgacgtggagaag
gtgtctgctttcgagaatccatacgtagatgccatcaagagtttatggaatgatcctgga
atccaggaatgctatgatcgacgacgagagtatcagttgtctgactctaccaaatactat
cttaatgacttggaccgcgttgctgaccccgcctacctgcctacgcagcaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgaccaagttctcgtg
gagtcggacaatgagaaccgaatggaggaaagcaaagcactctttagaacaattatcacc
tatccctggttccagaactcctcggttatcctattcttaaacaagaaagatcttctagag
gagaaaattatgtattcccacctagttgactacttcccagaatatgatggaccgcagaga
gatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaacccagacagt
gataaaattatctactcccacttcacgtgcgccacagacaccgagaacatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaacctggtctaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161857
Entry
111161857         CDS       T05871                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04270  Vascular smooth muscle contraction
elk04540  Gap junction
elk04725  Cholinergic synapse
elk04730  Long-term depression
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk05142  Chagas disease
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111161857
   04022 cGMP-PKG signaling pathway
    111161857
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111161857
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111161857
   04929 GnRH secretion
    111161857
   04912 GnRH signaling pathway
    111161857
   04935 Growth hormone synthesis, secretion and action
    111161857
   04928 Parathyroid hormone synthesis, secretion and action
    111161857
   04925 Aldosterone synthesis and secretion
    111161857
   04927 Cortisol synthesis and secretion
    111161857
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111161857
  09156 Nervous system
   04725 Cholinergic synapse
    111161857
   04730 Long-term depression
    111161857
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161857
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111161857
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111161857
   05163 Human cytomegalovirus infection
    111161857
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111161857
   05142 Chagas disease
    111161857
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111161857
   04031 GTP-binding proteins [BR:elk04031]
    111161857
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111161857
  Exosomal proteins of melanoma cells
   111161857
GTP-binding proteins [BR:elk04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    111161857
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 AAA_29
Other DBs
NCBI-GeneID: 111161857
NCBI-ProteinID: XP_022381583
UniProt: A0A2Y9L8E2
LinkDB
Position
Unknown
AA seq 353 aa
MACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAG
YSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEH
RYVHAIKTLWDDPGIQECYDRRREYQLSDSAKYYLADVDRIATSGYLPTQQDVLRVRVPT
TGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNEN
RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQRDAQAAR
EFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcgtgctgcctcagcgatgaggtgaaggagtccaagcggatcaacgccgagatcgag
aagcagctgcggcgggacaagcgcgacgcccggcgcgagctgaagctgctgctgctcggc
accggcgagagcgggaagagcacgttcatcaagcagatgcgcatcatccacggggcgggc
tactcggaggaggacaagcggggcttcaccaagctcgtgtaccagaacatcttcacggcc
atgcaggccatgatccgcgccatggagaccctgaagatcctgtacaagtacgagcagaac
aaggccaatgcgctcttgatccgcgaggtggacgtggagaaggtgacgacgttcgagcac
cgctatgtgcacgccatcaagaccctgtgggacgaccctggcatccaggagtgctatgac
cgcaggcgggaataccagctctccgactccgccaagtactacctggcagacgtggaccgc
attgccacctcgggctacctgcccacccagcaagacgtgcttcgggtccgtgtgcccacc
actggcatcatcgagtaccctttcgacctggagaacatcatcttcaggatggtggacgtg
gggggacagcggtctgagcggaggaagtggatccactgcttcgagaacgtgacgtccatc
atgttcctcgtggccctgagtgaatacgaccaggtgctggtggagtcggacaacgagaac
cgcatggaggagagcaaagccctgtttcggaccatcatcacctacccctggttccagaac
tcctcggtcatcctattcctcaacaagaaggacctgctggaggacaagatcctgcactcc
cacctggtcgactacttccccgagttcgacgggccacagcgggacgcgcaggccgcccgg
gagttcatcctgaagatgtttgtggacctgaatcccgacagcgacaagatcatctactcc
cacttcacctgcgccaccgacacggagaacatccgcttcgtgttcgcggccgtcaaggac
accatcctgcagctcaacctgaaggagtacaacctggtctga

DBGET integrated database retrieval system